spacer

EBI Dbfetch

ID   AM279417; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM279417;
XX
DT   13-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial DRB1 gene for MHC class II antigen, exon 2
XX
KW   DRB1 gene; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   McWhinnie A.J.M.;
RT   ;
RL   Submitted (13-JUN-2006) to the INSDC.
RL   McWhinnie A.J.M., Research Institute, Anthony Nolan Trust, Royal Free
RL   Hospital,Fleet Road,Hampstead,London., NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Dunne C., Crowley J.;
RT   "Sequence of new HLA-DRB1*13 allele DRB1*13XX.";
RL   Unpublished.
XX
DR   MD5; ef4fccdb363746c0e3dcc821e85d4409.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Ireland"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*13new"
FT   exon            1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*13new"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1"
FT                   /allele="DRB1*13new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /function="Antigen presentation"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:74"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAK50561.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDIREDERAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 65 C; 98 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatccg ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer