spacer

EBI Dbfetch

ID   AM158254; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM158254;
XX
DT   16-NOV-2005 (Rel. 85, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*1371
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1371 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   McWhinnie A.J.M.;
RT   ;
RL   Submitted (15-NOV-2005) to the INSDC.
RL   McWhinnie A.J.M., Research, Anthony Nolan Research Institute, Royal Free
RL   Hospital, Fleet Road, Hampstead, London. NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00753.x.
RX   PUBMED; 17493158.
RA   McWhinnie A.J., Shah A., Peat J., Tavarozzi F., Little A.M.;
RT   "Description of HLA-DRB1*1371 allele, which has the 3' intron 1 sequence
RT   and HLA-DQB1 association normally seen with a DRB1*0301 allele";
RL   Tissue Antigens 69(3):284-285(2007).
XX
DR   MD5; 8c3145d6f521138c9d408780af699265.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="Variant of DRB1*13 differing by one nucleotide from
FT                   DRB1*1327."
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1371"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:71"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAJ43560.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1371"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 66 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer