Dbfetch

ID   AL834529; SV 1; linear; mRNA; HTC; HUM; 1759 BP.
XX
AC   AL834529;
XX
DT   12-JUL-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA; cDNA DKFZp434H2111 (from clone DKFZp434H2111)
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1759
RG   The German cDNA Consortium
RA   Bahr A., Lauber J., Mewes H.W., Weil B., Amid C., Osanger A., Fobo G.,
RA   Han M., Wiemann S.;
RT   ;
RL   Submitted (22-SEP-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; f202927749dbe5a9fc6c775f64a1ebb7.
DR   Ensembl-Gn; ENSG00000188906; homo_sapiens.
DR   Ensembl-Tr; ENST00000298910; homo_sapiens.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by Qiagen (Hilden/Germany) within the cDNA sequencing
CC   consortium of the German Genome Project.
CC   This clone (DKFZp434H2111) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp434H2111
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1759
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="434 (synonym: htes3). Vector pSport1; host
FT                   DH10B; sites NotI + SalI"
FT                   /clone="DKFZp434H2111"
FT                   /tissue_type="testis"
FT                   /note="hypothetical protein, N-terminus truncated"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..1203
FT                   /codon_start=1
FT                   /gene="DKFZp434H2111"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q5S007"
FT                   /db_xref="H-InvDB:HIT000029259.16"
FT                   /db_xref="HGNC:HGNC:18618"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020859"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032171"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="PDB:2ZEJ"
FT                   /db_xref="PDB:3D6T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5S007"
FT                   /protein_id="CAD39185.1"
FT                   /translation="VFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCG
FT                   HTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTED
FT                   GKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKI
FT                   LNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAF
FT                   SDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKM
FT                   SYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLK
FT                   NVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSV
FT                   E"
XX
SQ   Sequence 1759 BP; 596 A; 275 C; 342 G; 546 T; 0 other;
     gtctttgaca ttttgaattc agctgaatta gtctgtctga cgagacgcat tttattacct        60
     aaaaacgtaa ttgttgaatg catggttgct acacatcaca acagcaggaa tgcaagcatt       120
     tggctgggct gtgggcacac cgacagagga cagctctcat ttcttgactt aaatactgaa       180
     ggatacactt ctgaggaagt tgctgatagt agaatattgt gcttagcctt ggtgcatctt       240
     cctgttgaaa aggaaagctg gattgtgtct gggacacagt ctggtactct cctggtcatc       300
     aataccgaag atgggaaaaa gagacatacc ctagaaaaga tgactgattc tgtcacttgt       360
     ttgtattgca attccttttc caagcaaagc aaacaaaaaa attttctttt ggttggaacc       420
     gctgatggca agttagcaat ttttgaagat aagactgtta agcttaaagg agctgctcct       480
     ttgaagatac taaatatagg aaatgtcagt actccattga tgtgtttgag tgaatccaca       540
     aattcaacgg aaagaaatgt aatgtgggga ggatgtggca caaagatttt ctccttttct       600
     aatgatttca ccattcagaa actcattgag acaagaacaa gccaactgtt ttcttatgca       660
     gctttcagtg attccaacat cataacagtg gtggtagaca ctgctctcta tattgctaag       720
     caaaatagcc ctgttgtgga agtgtgggat aagaaaactg aaaaactctg tggactaata       780
     gactgcgtgc actttttaag ggaggtaatg gtaaaagaaa acaaggaatc aaaacacaaa       840
     atgtcttatt ctgggagagt gaaaaccctc tgccttcaga agaacactgc tctttggata       900
     ggaactggag gaggccatat tttactcctg gatctttcaa ctcgtcgact tatacgtgta       960
     atttacaact tttgtaattc ggtcagagtc atgatgacag cacagctagg aagccttaaa      1020
     aatgtcatgc tggtattggg ctacaaccgg aaaaatactg aaggtacaca aaagcagaaa      1080
     gagatacaat cttgcttgac cgtttgggac atcaatcttc cacatgaagt gcaaaattta      1140
     gaaaaacaca ttgaagtgag aaaagaatta gctgaaaaaa tgagacgaac atctgttgag      1200
     taagagagaa ataggaattg tctttggata ggaaaattat tctctcctct tgtaaatatt      1260
     tattttaaaa atgttcacat ggaaagggta ctcacatttt ttgaaatagc tcgtgtgtat      1320
     gaaggaatgt tattattttt aatttaaata tatgtaaaaa tacttaccag taaatgtgta      1380
     ttttaaagaa ctatttaaaa cacaatgtta tatttcttat aaataccagt tactttcgtt      1440
     cattaattaa tgaaaataaa tctgtgaagt acctaattta agtactcata ctaaaattta      1500
     taaggccgat aattttttgt tttcttgtct gtaatggagg taaactttat tttaaattct      1560
     gtgcttaaga caggactatt gcttgtcgat ttttctagaa atctgcacgg tataatgaaa      1620
     atattaagac agtttcccat gtaatgtatt ccttcttaga ttgcatcgaa atgcactatc      1680
     atatatgctt gtaaatattc aaatgaattt gcactaataa agtcctttgt tggtatgtga      1740
     aaaaaaaaaa aaaaaaaaa                                                   1759
//