Dbfetch

ID   AL833966; SV 1; linear; mRNA; HTC; HUM; 1884 BP.
XX
AC   AL833966;
XX
DT   12-JUL-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA; cDNA DKFZp761H191 (from clone DKFZp761H191)
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1884
RG   The German cDNA Consortium
RA   Ottenwaelder B., Obermaier B., Deutschenbaur S., Schaipp A., Mewes H.W.,
RA   Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (22-SEP-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; f643c328699b71243bb7164d61803f7c.
DR   Ensembl-Gn; ENSG00000159363; homo_sapiens.
DR   Ensembl-Tr; ENST00000326735; homo_sapiens.
DR   Ensembl-Tr; ENST00000341676; homo_sapiens.
DR   Ensembl-Tr; ENST00000452699; homo_sapiens.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by Medigenomix (Martinsried/Germany) within the cDNA sequencing
CC   consortium of the German Genome Project.
CC   This clone (DKFZp761H191) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp761H191
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1884
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="761 (synonym: hamy2). Vector pSport1; host
FT                   DH10B; sites NotI + SalI"
FT                   /clone="DKFZp761H191"
FT                   /tissue_type="amygdala"
FT                   /note="hypothetical protein, N-terminus truncated, not
FT                   fully spliced"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..1122,1295..1603)
FT                   /codon_start=1
FT                   /gene="DKFZp761H191"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9NQ11"
FT                   /db_xref="H-InvDB:HIT000028839.17"
FT                   /db_xref="HGNC:HGNC:30213"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
FT                   /protein_id="CAD38813.2"
FT                   /translation="QQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMV
FT                   TGDNLQTAVTVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQ
FT                   AASYTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAPEQKTELVCELQ
FT                   KLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPMVIREGRCS
FT                   LDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPAL
FT                   VLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVAAPDNLPN
FT                   YENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALLSSVLVGLVLVPGLLQ
FT                   GPLALRNITDTGFKLLLLGLVTLNFVGAFMLESVLDQCLPACLRRLRPKRASKKRFKQL
FT                   ERELAEQPWPPLPAGPLR"
XX
SQ   Sequence 1884 BP; 336 A; 635 C; 570 G; 343 T; 0 other;
     cagcaactga cgagggacac tgtggaagga gacctgagcc tcctggggct gctggtcatg        60
     aggaacctac tgaagccgca gacaacgcca gttatccagg ctctgcgaag gacccgcatc       120
     cgcgccgtca tggtgacagg ggacaacctg cagacagcgg tgactgtggc ccggggctgt       180
     ggcatggtgg ccccccagga gcatctgatc atcgtccacg ccacccaccc tgagcggggt       240
     cagcctgcct ctctcgagtt cctgccgatg gagtccccca cagccgtgaa tggcgttaag       300
     gatcctgacc aggctgcaag ctacaccgtg gagccagacc cccgatccag gcacctggcc       360
     ctcagcgggc ccacctttgg tatcattgtg aagcacttcc ccaagctgct gcccaaggtc       420
     ctggtccagg gcactgtctt tgcccgcatg gcccctgagc agaagacaga gctggtgtgc       480
     gagctacaga agcttcagta ctgcgtgggc atgtgcggag acggcgccaa tgactgtggg       540
     gccctgaagg cggctgatgt cggcatctcg ctgtcccagg cagaagcctc agtggtctca       600
     cccttcacct cgagcatggc cagtattgag tgcgtgccca tggtcatcag ggaggggcgc       660
     tgttcccttg acacttcgtt cagcgtcttc aagtacatgg ctctgtacag cctgacccag       720
     ttcatctccg tcctgatcct ctacacgatc aacaccaacc tgggtgacct gcagttcctg       780
     gccatcgacc tggtcatcac caccacagtg gcagtgctca tgagccgcac ggggccagcg       840
     ctggtcctgg gacgggtgcg gccaccgggg gcgctgctca gcgtgcccgt gctcagcagc       900
     ctgctgctgc agatggtcct ggtgaccggc gtgcagctag ggggctactt cctgaccctg       960
     gcccagccat ggttcgtgcc tctgaacagg acagtggccg caccagacaa cctgcccaac      1020
     tacgagaaca ccgtggtctt ctctctgtcc agcttccagt acctcatcct ggctgcagcc      1080
     gtgtccaagg gggcgccctt ccgccggccg ctctacacca atggtgccac tgcgggcgcg      1140
     ggcgggagat gctggcggag ggagggagga gccctggggt gctggggagg cagatgggag      1200
     agaggtgccg gccgagtgga agactggcgt gcacacgtgt gtctgtgggt gccggggggg      1260
     cgtggctcct gcctgagaga ctctcctgct cccagtgccc ttcctggtgg ccctggcgct      1320
     cctgagctcc gtcctggtgg gccttgtcct ggtccccggc ctcctgcagg ggccgctggc      1380
     gctgaggaac atcactgaca ctggcttcaa gctgctgctg ctgggtctgg tcaccctcaa      1440
     cttcgtgggg gccttcatgc tggagagcgt gctagaccag tgcctccccg cctgcctgcg      1500
     ccgcctccgg cccaagcggg cctccaagaa gcgcttcaag cagctggaac gagagctggc      1560
     cgagcagccc tggccaccgc tgcccgccgg ccccctgagg tagtgcaggc ccacgggcac      1620
     cccagacact ggaactccct gcctctgagc caccaactgg acccctctcc agcaacacca      1680
     ccgccaccac ctcccacatc cctgaggttg gcgactgtct acactcctcc cccgagacca      1740
     cccccaccct ggggaagcgt cgactactgt cccctacctt ggaccatccc gcgtaggggt      1800
     ggcagccccc agctcccctc agtgctgctg tcagtgtagc aaataaagtc atgatatttt      1860
     cctggaaaaa aaaaaaaaaa aaaa                                             1884
//