Dbfetch

ID   AL713634; SV 1; linear; mRNA; STD; HUM; 4699 BP.
XX
AC   AL713634;
XX
DT   20-MAR-2002 (Rel. 71, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mRNA; cDNA DKFZp761G1421 (from clone DKFZp761G1421)
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4699
RA   Wambutt R., Heubner D., Mewes H.W., Weil B., Wiemann S.;
RT   ;
RL   Submitted (12-MAR-2002) to the INSDC.
RL   MIPS, Am Klopferspitz 18a, D-82152 Martinsried, GERMANY
XX
DR   MD5; 667b2788ad0dd7b7195672e94900b42c.
DR   Ensembl-Gn; ENSG00000197283; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227460; homo_sapiens.
DR   Ensembl-Tr; ENST00000395071; homo_sapiens.
DR   Ensembl-Tr; ENST00000414753; homo_sapiens.
DR   Ensembl-Tr; ENST00000418600; homo_sapiens.
DR   Ensembl-Tr; ENST00000428982; homo_sapiens.
DR   Ensembl-Tr; ENST00000455687; homo_sapiens.
DR   Ensembl-Tr; ENST00000628646; homo_sapiens.
DR   Ensembl-Tr; ENST00000629380; homo_sapiens.
DR   EuropePMC; PMC2925262; 19196676.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
CC   Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by AGOWA (Berlin/Germany) within the cDNA sequencing
CC   consortium of the German Genome Project.
CC   This clone (DKFZp761G1421) is available at the RZPD in Berlin.
CC   Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6,
CC   14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de
CC   Further information about the clone and the sequencing project
CC   is available at http://mips.gsf.de/proj/cDNA/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4699
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="761 (synonym: hamy2). Vector pSport1; host
FT                   DH10B; sites NotI + SalI"
FT                   /clone="DKFZp761G1421"
FT                   /tissue_type="amygdala"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..2709
FT                   /codon_start=1
FT                   /gene="DKFZp761G1421"
FT                   /product="hypothetical protein"
FT                   /note="synaptic ras GTPase-activating protein p13 SynGAP"
FT                   /db_xref="GOA:Q96PV0"
FT                   /db_xref="H-InvDB:HIT000026559.15"
FT                   /db_xref="HGNC:HGNC:11497"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR021887"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="InterPro:IPR023315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96PV0"
FT                   /protein_id="CAD28452.1"
FT                   /translation="GSGGGSGGKGKGGCPAVRLKARYQTMSILPMELYKEFAEYVTNHY
FT                   RMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFREN
FT                   TLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAEHQANLRMC
FT                   CELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSP
FT                   SLFGLMQEYPDEQTSRTLTLIAKVIQNLANFSKFTSKEDFLGFMNEFLELEWGSMQQFL
FT                   YEISNLDTLTNSSSFEGYIDLGRELSTLHALLWEVLPQLSKEALLKLGPLPRLLNDIST
FT                   ALRNPNIQRQPSRQSERPRPQPVVLRGPSAEMQGYMMRDLNSSIDLQSFMARGLNSSMD
FT                   MARLPSPTKEKPPPPPPGGGKDLFYVSRPPLARSSPAYCTSSSDITEPEQKMLSVNKSV
FT                   SMLDLQGDGPGGRLNSSSVSNLAAVGDLLHSSQASLTAALGLRPAPAGRLSQGSGSSIT
FT                   AAGMRLSQMGVTTDGVPAQQLRIPLSFQNPLFHMAADGPGPPGGHGGGGGHGPPSSHHH
FT                   HHHHHHHRGGEPPGDTFAPFHGYSKSEDLSSGVPKPPAASILHSHSYSDEFGPSGTDFT
FT                   RRQLSLQDNLQHMLSPPQITIGPQRPAPSGPGGGSGGGSGGGGGGQPPPLQRGKSQQLT
FT                   VSAAQKPRPSSGNLLQSPEPSYGPARPRQQSLSKEGSIGGSGGSGGGGGGGLKPSITKQ
FT                   HSQTPSTLNPTMPASERTVAWVSNMPHLSADIESAHIEREEYKLKEYSKSMDESRLDRV
FT                   KEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAE
FT                   KDSQIKSIIGSPSLQADAGGGGAAPGPPRHG"
FT   regulatory      4656..4661
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4677
XX
SQ   Sequence 4699 BP; 957 A; 1499 C; 1268 G; 975 T; 0 other;
     ggctcggggg gtggctcagg gggcaagggc aaaggaggtt gcccggctgt gcggctgaaa        60
     gcacgttacc agacaatgag catcttgccc atggagctat ataaagagtt tgcagagtat       120
     gtcaccaacc attatcggat gctgtgtgca gtcttggagc ccgccctgaa tgtcaaaggc       180
     aaggaggagg ttgccagtgc actagttcac atcctgcaga gtacaggcaa ggccaaggac       240
     ttcctttcag acatggccat gtctgaggta gaccggttca tggaacggga gcacctcata       300
     ttccgcgaga acacgcttgc cactaaagcc atagaagagt atatgagact gattggtcag       360
     aaatacctca aggatgccat tggagaattc atccgtgctc tgtatgaatc tgaggaaaac       420
     tgcgaggtag accctatcaa gtgcacagca tccagtttgg cagagcacca ggccaacctg       480
     cgaatgtgct gtgagttggc cctgtgcaag gtggtcaact cccactgcgt gttcccgagg       540
     gagctgaagg aggtgtttgc ttcatggcgg ctgcgctgcg cagagcgagg ccgggaggac       600
     atcgcagaca ggcttatcag cgcctcactc ttcctgcgct tcctctgccc agcgattatg       660
     tcgcccagtc tctttgggct tatgcaggag tacccagatg agcagacctc acgaaccctc       720
     accctcattg ccaaggtcat ccagaacctg gccaactttt ccaagtttac ctcaaaggag       780
     gactttctgg gcttcatgaa tgagtttctg gagctggaat ggggttccat gcagcagttt       840
     ttgtatgaga tctccaatct ggacacgcta accaacagca gtagctttga gggttacatc       900
     gacttgggcc gagagctctc cacactgcat gccctactct gggaggtgct gccccagctc       960
     agcaaggaag ccctcctgaa gctgggtcca ctgccccggc tcctcaacga catcagcaca      1020
     gctctgagga accccaacat ccaaaggcag ccaagccgcc agagtgagcg gccccggcct      1080
     cagcctgtgg tactgcgggg gccatcggct gagatgcagg gctacatgat gcgggacctc      1140
     aacagctcca tcgaccttca gtccttcatg gctcgaggcc tcaacagctc tatggacatg      1200
     gctcgcctcc cctccccaac caaggaaaag ccacccccac caccgcctgg tggtggtaaa      1260
     gacctgttct atgtaagccg tccacccctg gcccgttcct caccagcata ctgcacgagc      1320
     agctcggaca tcacagagcc agagcagaag atgctgagtg tcaacaagag tgtgtccatg      1380
     ctggacttac agggtgatgg gcctggtggc cgcctcaaca gcagcagtgt ttcgaacctg      1440
     gcggccgtag gggacctgct gcactcaagc caggcctcgc tgacagcagc cttggggcta      1500
     cggcctgcgc ctgccggacg cctctcccag gggagtggct catccatcac ggcggctggc      1560
     atgcgcctca gccagatggg tgtcaccaca gacggtgtcc ctgcccagca actgcgaatc      1620
     cccctctcct tccagaaccc tctcttccac atggctgctg atgggccagg tcccccaggc      1680
     ggccatggag ggggcggtgg ccatggccca ccttcctccc atcaccacca ccaccaccat      1740
     caccaccacc gaggtggaga gccccctggg gacacctttg ccccattcca tggctatagc      1800
     aagagtgagg acctctcttc cggggtcccc aagccccctg ctgcctccat ccttcatagc      1860
     cacagctaca gtgatgagtt tggaccctct ggcactgact tcacccgtcg gcagctttca      1920
     ctccaggaca acctgcagca catgctgtcc cctccccaga tcaccattgg tccccagagg      1980
     ccagccccct cagggcctgg aggtgggagc ggtgggggca gcggtggggg tggcgggggc      2040
     cagccgcctc cattgcagag gggcaagtct cagcagttga cagtcagcgc agcccagaaa      2100
     ccccggccat ccagcgggaa tctattgcag tccccagagc caagttatgg ccccgcccgt      2160
     ccacggcaac agagcctcag caaggagggc agcattgggg gcagcggggg cagcggtggc      2220
     ggagggggtg gggggctgaa gccctccatc accaagcagc attctcagac accatccaca      2280
     ttgaacccca caatgccagc ctctgagcgg acagtggcct gggtctccaa catgcctcac      2340
     ctgtcggctg acatcgagag tgcccacatc gagcgggaag agtacaagct caaggagtac      2400
     tcaaaatcga tggatgagag ccggctggat agggtgaagg agtacgagga ggagattcac      2460
     tcactgaaag agcggctgca catgtccaac cggaagctgg aagagtatga gcggaggctg      2520
     ctgtcccagg aagaacaaac cagcaaaatc ctgatgcagt atcaggcccg actggagcag      2580
     agtgagaaga ggctaaggca gcagcaggca gagaaggatt cccagatcaa gagcatcatt      2640
     ggcagcccgt cccttcaggc tgatgctggt ggaggaggag ctgcgccggg accaccccgc      2700
     catggctgag ccgctgccag aacccaagaa gaggctgctc gacgctcaga gaggcagctt      2760
     ccccccttgg gtccaacaaa cccgcgtgtg acgctggccc caccgtggaa tggcctggcc      2820
     cccccagccc caccaccccc accccggctg cagattacgg agaacggcga gttccgaaac      2880
     accgcagacc actagcccac ccagcatcag agaccttctc ttcctttcct gtgcacccca      2940
     ccctgtaaca gcaccaacca ccaggattgg acatcaccga ggaacagcgg gattgcctcc      3000
     ccgaatgcct ccctgggagg cacactgatt gcccaccccc accactgcac catttccagg      3060
     agggagagtg gggaccctca gccgccccct tttccttccc attggggtgc tgccctctct      3120
     ttgaccccca gggacccttg ccccaggaca ccgcctaccc cgtacagacc ccttcactcc      3180
     ggggtgctat ccccatcctc tgcctcatcg ttcccctgag cactggggga cagaccctca      3240
     cccccaccct gggggtgtgg cacctccaaa ctttcaactt cagggtgatt tttttagcag      3300
     taaccagagc tgacaatcta actcccctcc accgccccat tttggcctcc cctgcccccc      3360
     ttgttatggg gaggggaccc cgggtgaggg ggccctatta ccccttgatt tctcaggagc      3420
     gtctgggggg gctcagcacg cacaaactcc ttctccttct accactctta aatttactcc      3480
     ctccccaccc agaacccaga tggggtggag ggggccaccg gggcagggag ggggcggcaa      3540
     ggggggaatg ggagttgtct ccccttctcc ccacacctga tctgctctcg gctggtccca      3600
     gagcggggtg agggggctta tgcccccccc tcccccagtg tgttgggtgg ggtggaattg      3660
     aggttagggt gaggggtcag ggtttgggag ggtgtgtatg ttgggaggac aggctagttg      3720
     atctgtccta ctctgacaca cagtcccctc tgccccttcc ttctctcttc ttggtctcta      3780
     ctcccagggg gaggggggaa cttactctag gaaaagccat gtctctctcc cccagggtgg      3840
     ggggacctgt gttggaggag gggtgttggg gggccccctt ccatgactct gtcccctggg      3900
     ggaggtagga cagggctggg cttccctctc atcctccccc tcccaatctc cttccacctc      3960
     cctccctccc gccagctcca cgatttttcg gtgtttctct gtacatagtt ttctggcggg      4020
     ataggggagg taggatggat ggggtttggg gtgggtaggc catgggaggg gagaagcccc      4080
     tccttggcac cccctcttcc ctgactgctg tcccctaccc agccttgccc ccttcatcct      4140
     tttgcgtttg gtattgagac tctcctagac tctactcctc tttcttttgt atggacagtt      4200
     ccccttcagt cccatccccc tacacataca cccagccggg gccaaattta tacttatata      4260
     aaagttgtaa atatgtgaaa ttttatccct gtgccctttc cccacctcag gccctacccc      4320
     tggaccctcc ccaaccttcc ttctctcttc tttggctgtt gtaattatct ggggtttgta      4380
     ctgtacatat ccggggtgtg tgtgtgtggg ctgggggcaa cccttctgta cagagcttcc      4440
     tggccccctc cccccccgcc cctctgcttc cctccccacc caccacctca agggtaggga      4500
     gttgctcttc ctacctgttt tattttgttt tctcgttctc cctccccacc ccactcccag      4560
     ccttatctat cccccctcac tgtccccttt tctccactcc cagccccatt tccttttttt      4620
     ctggagtgtg tggtgaaaca gaaaaaaaca tgtttaataa acggagattg ttcttttaag      4680
     aaaaaaaaaa aaaaaaaaa                                                   4699
//