Dbfetch

ID   AL512769; SV 1; linear; mRNA; STD; HUM; 1774 BP.
XX
AC   AL512769;
XX
DT   12-JAN-2001 (Rel. 66, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mRNA; cDNA DKFZp434E1211 (from clone DKFZp434E1211)
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1774
RA   Duesterhoeft A., Lauber J., Mewes H.W., Weil B., Wiemann S.;
RT   ;
RL   Submitted (15-DEC-2000) to the INSDC.
RL   MIPS, Am Klopferspitz 18a, D-82152 Martinsried, GERMANY
XX
DR   MD5; dec9592fb8372e88ddef3fb325e48c76.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
CC   Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by Qiagen (Hilden/Germany) within the cDNA sequencing
CC   consortium of the German Genome Project.
CC   This clone (DKFZp434E1211) is available at the RZPD in Berlin.
CC   Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6,
CC   14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de
CC   Further information about the clone and the sequencing project
CC   is available at http://www.mips.biochem.mpg.de/proj/cDNA/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1774
FT                   /organism="Homo sapiens"
FT                   /chromosome="16"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="434 (synonym: htes3). Vector pSport1; host
FT                   DH10B; sites NotI + SalI"
FT                   /clone="DKFZp434E1211"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..1495
FT                   /codon_start=2
FT                   /gene="DKFZp434E1211"
FT                   /product="hypothetical protein"
FT                   /note="VPS35"
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000026544.16"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /db_xref="PDB:5F0J"
FT                   /db_xref="PDB:5F0K"
FT                   /db_xref="PDB:5F0L"
FT                   /db_xref="PDB:5F0M"
FT                   /db_xref="PDB:5F0P"
FT                   /db_xref="PDB:5OSH"
FT                   /db_xref="PDB:5OSI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96QK1"
FT                   /protein_id="CAC21686.1"
FT                   /translation="IALIDRLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQDMPS
FT                   EDVVSLQVSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELTRLLK
FT                   IPVDTYNNILTVLKLKHFHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVDSIMN
FT                   LVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGG
FT                   NQRIRFTLPPLVFAAYQLAFRYKENSKVDDKWEKKCQKIFSFAHQTISALIKAELAELP
FT                   LRLFLQGALAAGEIGFENHETVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTFERMK
FT                   CFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVME
FT                   CLKKALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNL
FT                   ESSEETEQINKHFHNTLEHLRLRRESPESEGPIYEGLIL"
FT   polyA_site      1754
XX
SQ   Sequence 1774 BP; 545 A; 366 C; 362 G; 501 T; 0 other;
     cattgcttta attgatagat tagctttatt tgctcaccgt gaagatggac ctggaatccc        60
     agcggatatt aaactttttg atatattttc acagcaggtg gctacagtga tacagtctag       120
     acaagacatg ccttcagagg atgttgtatc tttacaagtc tctctgatta atcttgccat       180
     gaaatgttac cctgatcgtg tggactatgt tgataaagtt ctagaaacaa cagtggagat       240
     attcaataag ctcaaccttg aacatattgc taccagtagt gcagtttcaa aggaactcac       300
     cagacttttg aaaataccag ttgacactta caacaatatt ttaacagtct tgaaattaaa       360
     acattttcac ccactctttg agtactttga ctacgagtcc agaaagagca tgagttgtta       420
     tgtgcttagt aatgttctgg attataacac agaaattgtc tctcaagacc aggtggattc       480
     cataatgaat ttggtatcca cgttgattca agatcagcca gatcaacctg tagaagaccc       540
     tgatccagaa gattttgctg atgagcagag ccttgtgggc cgcttcattc atctgctgcg       600
     ctctgaggac cctgaccagc agtacttgat tttgaacaca gcacgaaaac attttggagc       660
     tggtggaaat cagcggattc gcttcacact gccacctttg gtatttgcag cttaccagct       720
     ggcttttcga tataaagaga attctaaagt ggatgacaaa tgggaaaaga aatgccagaa       780
     gattttttca tttgcccacc agactatcag tgctttgatc aaagcagagc tggcagaatt       840
     gcccttaaga ctttttcttc aaggagcact agctgctggg gaaattggtt ttgaaaatca       900
     tgagacagtc gcatatgaat tcatgtccca ggcattttct ctgtatgaag atgaaatcag       960
     cgattccaaa gcacagctag ctgccatcac cttgatcatt ggcacttttg aaaggatgaa      1020
     gtgcttcagt gaagagaatc atgaacctct gaggactcag tgtgcccttg ctgcatccaa      1080
     acttctaaag aaacctgatc agggccgagc tgtgagcacc tgtgcacatc tcttctggtc      1140
     tggcagaaac acggacaaaa atggggagga gcttcacgga ggcaagaggg taatggagtg      1200
     cctaaaaaaa gctctaaaaa tagcaaatca gtgcatggac ccctctctac aagtgcagct      1260
     ttttatagaa attctgaaca gatatatcta tttttatgaa aaggaaaatg atgcggtaac      1320
     aattcaggtt ttaaaccagc ttatccaaaa gattcgagaa gacctcccga atcttgaatc      1380
     cagtgaagaa acagagcaga ttaacaaaca ttttcataac acactggagc atttgcgctt      1440
     gcggcgggaa tcaccagaat ccgaggggcc aatttatgaa ggtctcatcc tttaaaaagg      1500
     aaatagctca ccatactcct ttccatgtac atccagtgag ggttttatta cgctaggttt      1560
     cccttccata gattgtgcct ttcagaaatg ctgaggtagg tttcccattt cttacctgtg      1620
     atgtgtttta cccagcacct ccggacactc accttcagga ccttaataaa attattcact      1680
     tggtaagtgt tcaagtcttt ctgatcaccc caagtagcat gactgatctg caatttaaaa      1740
     ttcctgtgat ctgtaaaaaa aaaaaaaaaa aaaa                                  1774
//