Dbfetch

ID   AL354615; SV 1; linear; mRNA; STD; HUM; 3840 BP.
XX
AC   AL354615;
XX
DT   02-MAY-2000 (Rel. 63, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Novel human gene mapping to chomosome 1
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3840
RA   Rhodes S., Huckle E.;
RT   ;
RL   Submitted (27-APR-2000) to the INSDC.
RL   E-mail contact: humquery@sanger.ac.uk
XX
DR   MD5; 0a51708fa69cd645e6a1150e0405ef6e.
DR   Ensembl-Gn; ENSG00000159363; homo_sapiens.
DR   Ensembl-Tr; ENST00000326735; homo_sapiens.
DR   Ensembl-Tr; ENST00000341676; homo_sapiens.
DR   Ensembl-Tr; ENST00000452699; homo_sapiens.
XX
CC   This cDNA sequence was assembled from public domain ESTs and single
CC   pass sequencing reads from expressed DNA templates, aligned to the
CC   genomic DNA sequence from the bacterial clone 37C10 (AL049569).
CC   The EST sequences listed match this sequence with an identity
CC   of at least 95% between the coordinates shown.
CC   Further information can be found at http://www.sanger.ac.uk/HGP/Chr1/
CC   Experimentally determined gene
CC   Sanger Centre name : dJ37C10.C1.3
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3840
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /map="1p36"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..44
FT                   /number=1
FT   CDS             35..3577
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9NQ11"
FT                   /db_xref="H-InvDB:HIT000250333.13"
FT                   /db_xref="HGNC:HGNC:30213"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
FT                   /protein_id="CAB89728.1"
FT                   /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPW
FT                   RVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFT
FT                   VQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVL
FT                   RYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVIS
FT                   IPVKSYPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQ
FT                   SQTLRDMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMV
FT                   NESSLTGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTG
FT                   FCTAKGGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIV
FT                   IRALDLVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGT
FT                   LTEDGLDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLK
FT                   MVESTGWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQ
FT                   RMSVVVAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKP
FT                   LPTVPSLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDN
FT                   LQTAVTVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASY
FT                   TVEPDPRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAPEQKTELVCELQKLQY
FT                   CVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPMVIREGRCSLDTS
FT                   FSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALVLGR
FT                   VRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVAAPDNLPNYENT
FT                   VVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALLSSVLVGLVLVPGLLQGPLA
FT                   LRNITDTGFKLLLLGLVTLNFVGAFMLESVLDQCLPACLRRLRPKRASKKRFKQLEREL
FT                   AEQPWPPLPAGPLR"
FT   exon            45..139
FT                   /number=2
FT   exon            140..322
FT                   /number=3
FT   misc_feature    complement(join(321..366,365..381))
FT                   /note="matches EST AA601386 from clone IMAGE:1100856"
FT   exon            323..381
FT                   /number=4
FT   exon            382..511
FT                   /number=5
FT   exon            512..591
FT                   /number=6
FT   misc_feature    521..591
FT                   /note="matches EST AA367383"
FT   misc_feature    582..957
FT                   /note="matches EST AW503046 from clone IMAGE:3073988"
FT   misc_feature    582..1055
FT                   /note="matches EST AW503042 from clone IMAGE:3073970"
FT   exon            592..669
FT                   /number=7
FT   exon            670..739
FT                   /number=8
FT   exon            740..874
FT                   /number=9
FT   exon            875..941
FT                   /number=10
FT   exon            942..1073
FT                   /number=11
FT   misc_feature    1072..1235
FT                   /note="matches EST AA326792"
FT   exon            1074..1229
FT                   /number=12
FT   misc_feature    1159..1416
FT                   /note="matches EST T19151 from clone a10004"
FT   exon            1230..1340
FT                   /number=13
FT   exon            1341..1387
FT                   /number=14
FT   exon            1388..1576
FT                   /number=15
FT   misc_feature    1528..1913
FT                   /note="matches EST AW247062 from clone IMAGE:2822594"
FT   exon            1577..1783
FT                   /number=16
FT   misc_feature    1767..1975
FT                   /note="matches EST T09153 from clone HIBBP79"
FT   exon            1784..1879
FT                   /number=17
FT   exon            1880..2039
FT                   /number=18
FT   exon            2040..2160
FT                   /number=19
FT   exon            2161..2285
FT                   /number=20
FT   exon            2286..2446
FT                   /number=21
FT   misc_feature    join(2287..2459,2561..2956)
FT                   /note="matches EST AW163138 from clone IMAGE:2783726"
FT   exon            2447..2563
FT                   /number=22
FT   exon            2564..2643
FT                   /number=23
FT   misc_feature    2643..2886
FT                   /note="matches EST AA359097"
FT   exon            2644..2796
FT                   /number=24
FT   exon            2797..2893
FT                   /number=25
FT   exon            2894..3117
FT                   /number=26
FT   exon            3118..3269
FT                   /number=27
FT   misc_feature    complement(join(3179..3208,3231..3834))
FT                   /note="matches EST AI694453 from clone IMAGE:2338239"
FT   exon            3270..3439
FT                   /number=28
FT   misc_feature    complement(join(3393..3472,3558..3805,3806..3840))
FT                   /note="matches EST AA977749 from clone IMAGE:1589627"
FT   misc_feature    join(3421..3488,3493..3702)
FT                   /note="matches EST H20364 from clone IMAGE:172875"
FT   exon            3440..3840
FT                   /number=29
FT   misc_feature    complement(3476..3840)
FT                   /note="matches EST AI015711 from clone IMAGE:1636139"
FT   misc_feature    complement(join(3508..3644,3636..3824))
FT                   /note="matches EST AI560050 from clone IMAGE:2211121"
FT   misc_feature    complement(3540..3840)
FT                   /note="matches EST AI061266 from clone IMAGE:1699709"
FT   misc_feature    complement(3558..3840)
FT                   /note="matches EST AI380589 from clone IMAGE:2107078"
FT   misc_feature    complement(3559..3840)
FT                   /note="matches EST AI334403 from clone IMAGE:1933609"
FT   misc_feature    complement(3582..3840)
FT                   /note="matches EST AW081719 from clone IMAGE:2587072"
FT   misc_feature    complement(3602..3840)
FT                   /note="matches EST R58916"
FT   misc_feature    complement(3679..3840)
FT                   /note="matches EST AW591743 from clone IMAGE:2793472"
FT   misc_feature    complement(3700..3840)
FT                   /note="matches EST AI887158 from clone IMAGE:2438061"
FT   misc_feature    complement(3728..3840)
FT                   /note="matches EST AI954171 from clone IMAGE:2549985"
XX
SQ   Sequence 3840 BP; 682 A; 1277 C; 1162 G; 719 T; 0 other;
     gcgccggggc cggcgatgag cgcgaggagc cggcatgagc gcagacagca gccctctcgt        60
     gggcagcacg cccaccggtt atgggaccct gacgataggg acatcaatag atcccctcag       120
     ctcctcagtt tcatccgtga ggctcagcgg ctactgtggc agtccatgga gggtcatcgg       180
     ctatcacgtc gtggtctgga tgatggctgg gatccctttg ctgctcttcc gttggaagcc       240
     cctgtggggg gtgcggctgc ggctccggcc ctgcaacctg gcccacgccg aaacactcgt       300
     tatcgaaata agagacaaag aggatagttc ctggcagctc ttcactgtcc aggtgcagac       360
     tgaggccatc ggcgagggca gcctggagcc gtccccacag tcccaggcag aggatggccg       420
     gagccaggcg gcagttgggg cggtaccaga gggtgcctgg aaggatacgg cccagctcca       480
     caagagcgag gaggcggtga gtgtcggaca gaagcgggtg ctgcggtatt acctcttcca       540
     gggccagcgc tatatctgga tcgagaccca gcaagccttc taccaggtca gcctcctgga       600
     ccatggccgc tcttgtgacg acgtccaccg ctcccgccat ggcctcagcc tccaggacca       660
     aatggtgagg aaggccattt acggccccaa cgtgatcagc ataccggtca agtcctaccc       720
     ccagctgctg gtggacgagg cactgaaccc ctactatggg ttccaggcct tcagcatcgc       780
     gctgtggctg gctgaccact actactggta cgccctgtgc atcttcctca tttcctccat       840
     ctccatctgc ctgtcgctgt acaagaccag aaagcaaagc cagactctaa gggacatggt       900
     caagttgtcc atgcgggtgt gcgtgtgccg gccaggggga gaggaagagt gggtggactc       960
     cagtgagcta gtgcccggag actgcctggt gctgccccag gagggtgggc tgatgccctg      1020
     tgatgccgcc ctggtggccg gcgagtgcat ggtgaatgag agctctctga caggagagag      1080
     cattccagtg ctgaagacgg cactgccgga ggggctgggg ccctactgtg cagagacaca      1140
     ccggcggcac acactcttct gcgggaccct catcttgcag gcccgggcct atgtgggacc      1200
     gcacgtcctg gcagtggtga cccgcacagg gttctgcacg gcaaaagggg gcctggtgag      1260
     ctccatcttg cacccccggc ccatcaactt caagttctat aaacacagca tgaagtttgt      1320
     ggctgccctc tctgtcctgg ctctcctcgg caccatctac agcatcttca tcctctaccg      1380
     aaaccgggtg cctctgaatg agattgtaat ccgggctctc gacctggtga ccgtggtggt      1440
     gccacctgcc ctgcctgctg ccatgactgt gtgcacgctc tacgcccaga gccgactgcg      1500
     gagacagggc attttctgca tccacccact gcgcatcaac ctggggggca agctgcagct      1560
     ggtgtgtttc gacaagacgg gcaccctcac tgaggacggc ttagacgtga tgggggtggt      1620
     gcccctgaag gggcaggcat tcctgcccct ggtcccagag cctcgccgcc tgcctgtggg      1680
     gcccctgctc cgagcactgg ccacctgcca tgccctcagc cggctccagg acacccccgt      1740
     gggcgacccc atggacttga agatggtgga gtctactggc tgggtcctgg aggaagagcc      1800
     ggctgcagac tcagcatttg ggacccaggt cttggcagtg atgagacccc cactttggga      1860
     gccccagctg caggcaatgg aggagccccc ggtgccagtc agcgtcctcc accgcttccc      1920
     cttctcttcg gctctgcagc gcatgagtgt ggtggtggcg tggccagggg ccactcagcc      1980
     cgaggcctac gtcaaaggct ccccggagct ggtggcaggg ctctgcaacc ccgagacagt      2040
     gcccaccgac ttcgcccaga tgctgcagag ctatacagct gctggctacc gtgtcgtggc      2100
     cctggccagc aagccactgc ccactgtgcc cagcctggag gcagcccagc aactgacgag      2160
     ggacactgtg gaaggagacc tgagcctcct ggggctgctg gtcatgagga acctactgaa      2220
     gccgcagaca acgccagtta tccaggctct gcgaaggacc cgcatccgcg ccgtcatggt      2280
     gacaggggac aacctgcaga cagcggtgac tgtggcccgg ggctgtggca tggtggcccc      2340
     ccaggagcat ctgatcatcg tccacgccac ccaccctgag cggggtcagc ctgcctctct      2400
     cgagttcctg ccgatggagt cccccacagc cgtgaatggc gttaaggatc ctgaccaggc      2460
     tgcaagctac accgtggagc cagacccccg atccaggcac ctggccctca gcgggcccac      2520
     ctttggtatc attgtgaagc acttccccaa gctgctgccc aaggtcctgg tccagggcac      2580
     tgtctttgcc cgcatggccc ctgagcagaa gacagagctg gtgtgcgagc tacagaagct      2640
     tcagtactgc gtgggcatgt gcggagacgg cgccaatgac tgtggggccc tgaaggcggc      2700
     tgatgtcggc atctcgctgt cccaggcaga agcctcagtg gtctcaccct tcacctcgag      2760
     catggccagt attgagtgcg tgcccatggt catcagggag gggcgctgtt cccttgacac      2820
     ttcgttcagc gtcttcaagt acatggctct gtacagcctg acccagttca tctccgtcct      2880
     gatcctctac acgatcaaca ccaacctggg tgacctgcag ttcctggcca tcgacctggt      2940
     catcaccacc acagtggcag tgctcatgag ccgcacgggg ccagcgctgg tcctgggacg      3000
     ggtgcggcca ccgggggcgc tgctcagcgt gcccgtgctc agcagcctgc tgctgcagat      3060
     ggtcctggtg accggcgtgc agctaggggg ctacttcctg accctggccc agccatggtt      3120
     cgtgcctctg aacaggacag tggccgcacc agacaacctg cccaactacg agaacaccgt      3180
     ggtcttctct ctgtccagct tccagtacct catcctggct gcagccgtgt ccaagggggc      3240
     gcccttccgc cggccgctct acaccaatgt gcccttcctg gtggccctgg cgctcctgag      3300
     ctccgtcctg gtgggccttg tcctggtccc cggcctcctg caggggccgc tggcgctgag      3360
     gaacatcact gacaccggct tcaagctgct gctgctgggt ctggtcaccc tcaacttcgt      3420
     gggggccttc atgctggaga gcgtgctaga ccagtgcctc cccgcctgcc tgcgccgcct      3480
     ccggcccaag cgggcctcca agaagcgctt caagcagctg gaacgagagc tggccgagca      3540
     gccctggccg ccgctgcccg ccggccccct gaggtagtgc aggcccacgg gcaccccaga      3600
     cactggaact ccctgcctct gagccaccaa ctggacccct ctccagcaac accaccgcca      3660
     ccacctccca catccctgag gttggcgact gtctacactc ctcccccgag accaccccca      3720
     ccctggggaa gcgttgacta ctgtccccta ccttggacca tcccgcgtag gggtggcagc      3780
     ccccagctcc cctcagtgct gctgtcagtg tagcaaataa agtcatgata ttttcctggc      3840
//