spacer

EBI Dbfetch

ID   AL133088; SV 1; linear; mRNA; HTC; HUM; 1670 BP.
XX
AC   AL133088;
XX
DT   17-NOV-1999 (Rel. 61, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens mRNA; cDNA DKFZp434D0428 (from clone DKFZp434D0428)
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1670
RG   The German cDNA Consortium
RA   Bloecker H., Boecher M., Brandt P., Mewes H.W., Weil B., Amid C.,
RA   Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (22-SEP-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 0d5ecaa8d1306ae72e5cde760f7fdfe0.
DR   Ensembl-Gn; ENSG00000106009; homo_sapiens.
DR   Ensembl-Tr; ENST00000340611; homo_sapiens.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by GBF (National Research Centre for Biotechnology Ltd.,
CC   Braunschweig/Germany) within the cDNA sequencing consortium of the German
CC   Genome Project.
CC   This clone (DKFZp434D0428) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp434D0428
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1670
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="434 (synonym: htes3). Vector pSport1; host
FT                   DH10B; sites NotI + SalI"
FT                   /clone="DKFZp434D0428"
FT                   /tissue_type="testis"
FT                   /note="hypothetical protein, N-terminus truncated"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..1431
FT                   /codon_start=1
FT                   /gene="DKFZp434D0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q6PJG6"
FT                   /db_xref="H-InvDB:HIT000024990.17"
FT                   /db_xref="HGNC:HGNC:21701"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4IFI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PJG6"
FT                   /protein_id="CAB61405.1"
FT                   /translation="DDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASL
FT                   LGATVTVLRLCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQA
FT                   LAVLLECLESPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLRELFPVLQKR
FT                   LCHPCWEVRDSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESYVRASAVT
FT                   AMGQLSSQGLHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHAD
FT                   AAQDTEQFVATVLQAASQDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPA
FT                   QPLTEALRALCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPN
FT                   TASAEATLPRWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKSPQSLL
FT                   QDMLATGGFLQGDEADCY"
XX
SQ   Sequence 1670 BP; 314 A; 560 C; 518 G; 278 T; 0 other;
     gacgatgcca cgacggtgga cacactcctg gcctccaagt cgtcctgcgc cggcctcctg        60
     tgccgcaccc tggctcacct ggaggagctg cagccgctgc cccagcgccc ttcaccgtgg       120
     ccccaggcgt ctctactggg ggctacagtg actgtcctgc ggctctgtga cggctcggct       180
     gcccctgcct ccagtgtggg gggccacctc tgtgggaccc tggcgggctg cgtccgggtc       240
     cagcgagcag ccctcgactt cctggggacg ctgtcacagg ggacaggccc ccaggagctg       300
     gtgacgcagg cgcttgctgt cctcctggag tgcctcgaga gccccggctc cagccccacg       360
     gttctgaaga aggccttcca ggccacgctc aggtggctcc tgagctcacc caagaccccc       420
     ggctgctctg atctcggccc cctcatcccg cagttcctca gagagctgtt ccctgtgctg       480
     cagaaacgcc tgtgccaccc ctgctgggag gtgagggact ccgccctcga gttcctgacc       540
     cagctgagca ggcactgggg aggacaggct gacttcagat gcgcactctt ggcttcagag       600
     gtgcctcagc tggccctgca gctcctccag gaccctgaga gttatgtccg agcgagtgca       660
     gtgaccgcca tggggcagct gtccagccag ggcctgcacg cccccaccag ccctgagcat       720
     gcagaggccc ggcagagcct gttcctggag ctcctgcaca tcctctccgt agactcggag       780
     ggcttcccac ggcgggcggt catgcaagtc ttcactgagt ggctgcggga cggccacgcc       840
     gacgcggccc aggacacgga gcagttcgtg gccactgtgc tgcaggcggc gagccaggac       900
     ctggactggg aggtccgcgc ccagggcctg gagctggccc tcgtgttcct gggccagact       960
     ttggggccgc cgcgtaccca ctgcccctat gccgtggccc tacccgaggt ggccccagcc      1020
     cagccactca ccgaggcact gagggctctc tgccacgtgg ggctctttga cttcgccttt      1080
     tgtgccttgt ttgactgcga ccgccctgtg gcgcagaagt cttgtgacct ccttctcttc      1140
     ctgagggaca agattgcttc ctacagcagc ctgcgggagg ccaggggcag ccccaacact      1200
     gcctccgcag aggccaccct gccgaggtgg cgggcgggtg agcaggccca gcccccaggg      1260
     gaccaggagc ctgaggctgt gctggccatg ctcaggtccc tagacctgga gggcctgcgg      1320
     agcacgctgg ccgagagcag cgaccacgtg gagaagagtc cccagtccct cctgcaggac      1380
     atgctggcca cgggaggctt cctgcagggg gacgaggccg actgctactg agcagaacca      1440
     gactctgcca ctggggctca ggaccaaggg aggcagcacc atgtccttct gtgggacact      1500
     gccagcccca gggctccagc ccagcccggt ggatcctctg gggaagccag gaccaggaga      1560
     gaagcaaggt caagaaatcc cacagtttga tgtattaaag aaatgactta tttctactca      1620
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                 1670
//


spacer
spacer