Dbfetch

ID   AL096781; SV 1; linear; mRNA; STD; HUM; 1188 BP.
XX
AC   AL096781;
XX
DT   02-JUL-1999 (Rel. 60, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Novel human gene mapping to chomosome 22q13.33
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1188
RA   Smink L.J., Huckle E.J.;
RT   ;
RL   Submitted (02-JUL-1999) to the INSDC.
RL   E-mail contact: humquery@sanger.ac.uk
XX
DR   MD5; 57b0efadc049f3aa8609db19f8f4d02d.
DR   Ensembl-Gn; ENSG00000100288; homo_sapiens.
DR   Ensembl-Tr; ENST00000406938; homo_sapiens.
XX
CC   This cDNA sequence was assembled from public domain ESTs and single
CC   pass sequencing reads from expressed DNA templates, aligned to the
CC   genomic DNA sequence from the bacterial clone 384D8 (Em:U62317).
CC   The EST sequences listed match this sequence with an identity
CC   of at least 95% between the coordinates shown.
CC   Further information can be found at http://www.sanger.ac.uk/HGP/Chr22/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1188
FT                   /organism="Homo sapiens"
FT                   /chromosome="22"
FT                   /map="q13.33"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..224
FT                   /number=1
FT   CDS             1..1188
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9Y259"
FT                   /db_xref="H-InvDB:HIT000250147.11"
FT                   /db_xref="HGNC:HGNC:1938"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR026712"
FT                   /db_xref="PDB:2IG7"
FT                   /db_xref="PDB:3FEG"
FT                   /db_xref="PDB:3LQ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y259"
FT                   /protein_id="CAB46630.1"
FT                   /translation="MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDA
FT                   ERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLR
FT                   LYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVL
FT                   SAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEM
FT                   GNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF
FT                   CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLV
FT                   EVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS"
FT   exon            225..333
FT                   /number=2
FT   misc_feature    324..383
FT                   /note="matches EST AA465476 from clone IMAGE:814050"
FT   exon            334..447
FT                   /number=3
FT   exon            448..581
FT                   /number=4
FT   misc_feature    448..478
FT                   /note="matches EST T53978 from clone 74287"
FT   misc_feature    complement(499..581)
FT                   /note="matches EST AA465477 from clone IMAGE:814050"
FT   misc_feature    536..955
FT                   /note="matches EST AI301828 from clone IMAGE:1901328"
FT   misc_feature    join(581..739,735..796,796..819)
FT                   /note="matches EST AA326297"
FT   exon            582..677
FT                   /number=5
FT   misc_feature    join(625..923,923..940,964..1008,1041..1060)
FT                   /note="matches EST W73539 from clone 344450"
FT   misc_feature    625..835
FT                   /note="matches EST W32105 from clone 320724"
FT   misc_feature    complement(635..731)
FT                   /note="matches EST AI377457 from clone IMAGE:2065498"
FT   misc_feature    join(637..672,667..843,831..1160)
FT                   /note="matches EST AA533295 from clone IMAGE:997304"
FT   exon            678..736
FT                   /number=6
FT   misc_feature    complement(685..1188)
FT                   /note="matches EST AA694194 from clone 433440"
FT   exon            737..818
FT                   /number=7
FT   misc_feature    complement(join(746..786,819..932,952..1188))
FT                   /note="matches EST AA988928 from clone IMAGE:1602798"
FT   misc_feature    751..1074
FT                   /note="matches EST AA382394"
FT   misc_feature    760..1017
FT                   /note="matches EST AA412334 from clone 730327"
FT   misc_feature    complement(join(778..856,851..932,980..1188))
FT                   /note="matches EST AA677669 from clone 460454"
FT   misc_feature    complement(790..1188)
FT                   /note="matches EST AI401568 from clone IMAGE:2110109"
FT   misc_feature    complement(join(799..844,830..1188))
FT                   /note="matches EST AA603013 from clone IMAGE:1117989"
FT   misc_feature    818..1081
FT                   /note="matches EST T63640 from clone 80831"
FT   exon            819..927
FT                   /number=8
FT   misc_feature    complement(820..1188)
FT                   /note="matches EST AA824322 from clone 1391811"
FT   misc_feature    complement(join(874..890,917..1188))
FT                   /note="matches EST AI744203 from clone IMAGE:2217601"
FT   misc_feature    874..1188
FT                   /note="matches EST AA149411 from clone 502994"
FT   misc_feature    880..1188
FT                   /note="matches EST T30127"
FT   misc_feature    complement(881..1188)
FT                   /note="matches EST AI214279 from clone IMAGE:1942159"
FT   misc_feature    882..954
FT                   /note="matches EST AA633063 from clone IMAGE:1143490"
FT   misc_feature    complement(910..941)
FT                   /note="matches EST AI268288 from clone IMAGE:1880769"
FT   misc_feature    complement(913..1188)
FT                   /note="matches EST AI301632 from clone IMAGE:1898563"
FT   misc_feature    complement(924..1188)
FT                   /note="matches EST AA778813 from clone 452528"
FT   misc_feature    join(924..1032,1031..1116)
FT                   /note="matches EST W76418 from clone 345736"
FT   misc_feature    complement(925..1188)
FT                   /note="matches EST AI338432 from clone IMAGE:1938810"
FT   exon            928..1031
FT                   /number=9
FT   misc_feature    complement(934..1188)
FT                   /note="matches EST AI160290 from clone IMAGE:1705050"
FT   misc_feature    947..1188
FT                   /note="matches EST AA654633 from clone IMAGE:1202845"
FT   misc_feature    complement(974..1188)
FT                   /note="matches EST AI684306 from clone IMAGE:2267646"
FT   misc_feature    1031..1180
FT                   /note="matches EST AA075009 from clone 544565"
FT   exon            1032..1113
FT                   /number=10
FT   misc_feature    complement(1046..1188)
FT                   /note="matches EST AA935397 from clone IMAGE:1459640"
FT   exon            1114..1188
FT                   /number=11
XX
SQ   Sequence 1188 BP; 261 A; 333 C; 347 G; 247 T; 0 other;
     atggcggccg aggcgacagc tgtggccgga agcggggctg ttggcggctg cctggccaaa        60
     gacggcttgc agcagtctaa gtgcccggac actaccccaa aacggcggcg cgcctcgtcg       120
     ctgtcgcgtg acgccgagcg ccgagcctac caatggtgcc gggagtactt gggcggggcc       180
     tggcgccgag tgcagcccga ggagctgagg gtttaccccg tgagcggagg cctcagcaac       240
     ctgctcttcc gctgctcgct cccggaccac ctgcccagcg ttggcgagga gccccgggag       300
     gtgcttctgc ggctgtacgg agccatcttg cagggcgtgg actccctggt gctagaaagc       360
     gtgatgttcg ccatacttgc ggagcggtcg ctggggcccc agctgtacgg agtcttccca       420
     gagggccggc tggaacagta catcccaagt cggccattga aaactcaaga gcttcgagag       480
     ccagtgttgt cagcagccat tgccacgaag atggcgcaat ttcatggcat ggagatgcct       540
     ttcaccaagg agccccactg gctgtttggg accatggagc ggtacctaaa acagatccag       600
     gacctgcccc caactggcct ccctgagatg aacctgctgg agatgtacag cctgaaggat       660
     gagatgggca acctcaggaa gttactagag tctaccccat cgccagtcgt cttctgccac       720
     aatgacatcc aggaagggaa catcttgctg ctctcagagc cagaaaatgc tgacagcctc       780
     atgctggtgg acttcgagta cagcagttat aactataggg gctttgacat tgggaaccat       840
     ttttgtgagt gggtttatga ttatactcac gaggaatggc ctttctacaa agcaaggccc       900
     acagactacc ccactcaaga acagcagttg cattttattc gtcattacct ggcagaggca       960
     aagaaaggtg agaccctctc ccaagaggag cagagaaaac tggaagaaga tttgctggta      1020
     gaagtcagtc ggtatgctct ggcatcccat ttcttctggg gtctgtggtc catcctccag      1080
     gcatccatgt ccaccataga atttggttac ttggactatg cccagtctcg gttccagttc      1140
     tacttccagc agaaggggca gctgaccagt gtccactcct catcctga                   1188
//