spacer

EBI Dbfetch

ID   AL096780; SV 1; linear; mRNA; STD; HUM; 1540 BP.
XX
AC   AL096780;
XX
DT   02-JUL-1999 (Rel. 60, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Novel human gene mapping to chomosome 22p13.33 similar to mouse
DE   Choline/Ethanolamine Kinase (O55229).
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1540
RA   Smink L.J., Huckle E.J.;
RT   ;
RL   Submitted (02-JUL-1999) to the INSDC.
RL   E-mail contact: humquery@sanger.ac.uk
XX
DR   MD5; e926d9586c44d4af3442adf5b356fbb7.
DR   Ensembl-Gn; ENSG00000100288; homo_sapiens.
DR   Ensembl-Tr; ENST00000406938; homo_sapiens.
XX
CC   This cDNA sequence was assembled from public domain ESTs and single
CC   pass sequencing reads from expressed DNA templates, aligned to the
CC   genomic DNA sequence from the bacterial clone 384D8 (U62317).
CC   The EST sequences listed match this sequence with an identity
CC   of at least 95% between the coordinates shown.
CC   Further information can be found at http://www.sanger.ac.uk/HGP/Chr22/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1540
FT                   /organism="Homo sapiens"
FT                   /chromosome="22"
FT                   /map="q13.33"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..367
FT                   /number=1
FT   CDS             144..1331
FT                   /product="Choline/Ethanolamine Kinase"
FT                   /db_xref="GOA:Q9Y259"
FT                   /db_xref="H-InvDB:HIT000250146.13"
FT                   /db_xref="HGNC:HGNC:1938"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:2IG7"
FT                   /db_xref="PDB:3FEG"
FT                   /db_xref="PDB:3LQ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y259"
FT                   /protein_id="CAB46629.1"
FT                   /translation="MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDA
FT                   ERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLR
FT                   LYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVL
FT                   SAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEM
FT                   GNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF
FT                   CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLV
FT                   EVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS"
FT   exon            368..476
FT                   /number=2
FT   misc_feature    467..526
FT                   /note="matches EST AA465476 from clone IMAGE:814050"
FT   exon            477..590
FT                   /number=3
FT   exon            591..724
FT                   /number=4
FT   misc_feature    591..621
FT                   /note="matches EST T53978 from clone 74287"
FT   misc_feature    complement(642..724)
FT                   /note="matches EST AA465477 from clone IMAGE:814050"
FT   misc_feature    679..1098
FT                   /note="matches EST AI301828 from clone IMAGE:1901328"
FT   misc_feature    join(724..882,878..939,939..962)
FT                   /note="matches EST AA326297"
FT   exon            725..820
FT                   /number=5
FT   misc_feature    join(768..1066,1066..1083,1107..1151,1184..1203)
FT                   /note="matches EST W73539 from clone 344450"
FT   misc_feature    768..978
FT                   /note="matches EST W32105 from clone 320724"
FT   misc_feature    complement(778..874)
FT                   /note="matches EST AI377457 from clone IMAGE:2065498"
FT   misc_feature    join(780..815,810..986,974..1303)
FT                   /note="matches EST AA533295 from clone IMAGE:997304"
FT   exon            821..879
FT                   /number=6
FT   misc_feature    complement(join(828..1421,1421..1540))
FT                   /note="matches EST AA694194 from clone 433440"
FT   exon            880..961
FT                   /number=7
FT   misc_feature    complement(join(889..929,962..1075,1095..1421,1421..1499,
FT                   1498..1540))
FT                   /note="matches EST AA988928 from clone IMAGE:1602798"
FT   misc_feature    894..1217
FT                   /note="matches EST AA382394"
FT   misc_feature    join(903..1160,1510..1540)
FT                   /note="matches EST AA412334 from clone 730327"
FT   misc_feature    complement(join(921..999,994..1075,1123..1421,1421..1499,
FT                   1498..1540))
FT                   /note="matches EST AA677669 from clone 460454"
FT   misc_feature    complement(933..1540)
FT                   /note="matches EST AI401568 from clone IMAGE:2110109"
FT   misc_feature    complement(join(942..987,973..1410))
FT                   /note="matches EST AA603013 from clone IMAGE:1117989"
FT   misc_feature    961..1224
FT                   /note="matches EST T63640 from clone 80831"
FT   exon            962..1070
FT                   /number=8
FT   misc_feature    complement(join(963..1418,1420..1499,1498..1540))
FT                   /note="matches EST AA824322 from clone 1391811"
FT   misc_feature    join(1017..1389,1372..1485)
FT                   /note="matches EST AA149411 from clone 502994"
FT   misc_feature    complement(join(1017..1033,1060..1539))
FT                   /note="matches EST AI744203 from clone IMAGE:2217601"
FT   misc_feature    1023..1389
FT                   /note="matches EST T30127"
FT   misc_feature    complement(1024..1540)
FT                   /note="matches EST AI214279 from clone IMAGE:1942159"
FT   misc_feature    1025..1097
FT                   /note="matches EST AA633063 from clone IMAGE:1143490"
FT   misc_feature    complement(1053..1084)
FT                   /note="matches EST AI268288 from clone IMAGE:1880769"
FT   misc_feature    complement(1056..1540)
FT                   /note="matches EST AI301632 from clone IMAGE:1898563"
FT   misc_feature    complement(join(1067..1421,1421..1540))
FT                   /note="matches EST AA778813 from clone 452528"
FT   misc_feature    join(1067..1175,1174..1259)
FT                   /note="matches EST W76418 from clone 345736"
FT   misc_feature    complement(1068..1540)
FT                   /note="matches EST AI338432 from clone IMAGE:1938810"
FT   exon            1071..1174
FT                   /number=9
FT   misc_feature    complement(1077..1540)
FT                   /note="matches EST AI160290 from clone IMAGE:1705050"
FT   misc_feature    1090..1341
FT                   /note="matches EST AA654633 from clone IMAGE:1202845"
FT   misc_feature    complement(1117..1539)
FT                   /note="matches EST AI684306 from clone IMAGE:2267646"
FT   misc_feature    join(1174..1323,1330..1375)
FT                   /note="matches EST AA075009 from clone 544565"
FT   exon            1175..1256
FT                   /number=10
FT   exon            1257..1540
FT                   /number=11
XX
SQ   Sequence 1540 BP; 338 A; 441 C; 467 G; 294 T; 0 other;
     agccgaatag agccggagag acccgagtat gaccggagaa gcccaggccg gccggaagag        60
     gagccgagcg cggccggaag gaaccgagcc cgtccgaagg gagcggagcg cagcctggcc       120
     tggggcccgg tcgagcccgc gccatggcgg ccgaggcgac agctgtggcc ggaagcgggg       180
     ctgttggcgg ctgcctggcc aaagacggct tgcagcagtc taagtgcccg gacactaccc       240
     caaaacggcg gcgcgcctcg tcgctgtcgc gtgacgccga gcgccgagcc taccaatggt       300
     gccgggagta cttgggcggg gcctggcgcc gagtgcagcc cgaggagctg agggtttacc       360
     ccgtgagcgg aggcctcagc aacctgctct tccgctgctc gctcccggac cacctgccca       420
     gcgttggcga ggagccccgg gaggtgcttc tgcggctgta cggagccatc ttgcagggcg       480
     tggactccct ggtgctagaa agcgtgatgt tcgccatact tgcggagcgg tcgctggggc       540
     cccagctgta cggagtcttc ccagagggcc ggctggaaca gtacatccca agtcggccat       600
     tgaaaactca agagcttcga gagccagtgt tgtcagcagc cattgccacg aagatggcgc       660
     aatttcatgg catggagatg cctttcacca aggagcccca ctggctgttt gggaccatgg       720
     agcggtacct aaaacagatc caggacctgc ccccaactgg cctccctgag atgaacctgc       780
     tggagatgta cagcctgaag gatgagatgg gcaacctcag gaagttacta gagtctaccc       840
     catcgccagt cgtcttctgc cacaatgaca tccaggaagg gaacatcttg ctgctctcag       900
     agccagaaaa tgctgacagc ctcatgctgg tggacttcga gtacagcagt tataactata       960
     ggggctttga cattgggaac catttttgtg agtgggttta tgattatact cacgaggaat      1020
     ggcctttcta caaagcaagg cccacagact accccactca agaacagcag ttgcatttta      1080
     ttcgtcatta cctggcagag gcaaagaaag gtgagaccct ctcccaagag gagcagagaa      1140
     aactggaaga agatttgctg gtagaagtca gtcggtatgc tctggcatcc catttcttct      1200
     ggggtctgtg gtccatcctc caggcatcca tgtccaccat agaatttggt tacttggact      1260
     atgcccagtc tcggttccag ttctacttcc agcagaaggg gcagctgacc agtgtccact      1320
     cctcatcctg actccaccct cccactcctt ggatttctcc tggagcctcc agggcaggac      1380
     cttggaggga ggaacaacga gcagaaggcc ctggcgactg ggctgagccc ccaagtgaaa      1440
     ctgaggttca ggagaccggc ctgttcctga gtttgagtag gtccccatgg ctggcaggcc      1500
     agagccccgt gctgtgtatg taacacaata aacaagcttc                            1540
//


spacer
spacer