Dbfetch

ID   AK316333; SV 1; linear; mRNA; STD; HUM; 1209 BP.
XX
AC   AK316333;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA, FLJ79232 complete cds, highly similar to HLA class II
DE   histocompatibility antigen, DQB1*0602 beta chain precursor.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1209
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 300cd4e310d932e4fa0cf0353b2b39e9.
DR   Ensembl-Gn; ENSG00000179344; homo_sapiens.
DR   Ensembl-Tr; ENST00000399084; homo_sapiens.
DR   Ensembl-Tr; ENST00000434651; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1209
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="SPLEN2"
FT                   /clone="SPLEN2024407"
FT                   /tissue_type="spleen"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             75..860
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to HLA class II histocompatibility
FT                   antigen, DQB1*0602 beta chain precursor"
FT                   /db_xref="GOA:Q5Y7D6"
FT                   /db_xref="H-InvDB:HIT000499946.4"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5Y7D6"
FT                   /protein_id="BAH14704.1"
FT                   /translation="MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKG
FT                   MCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTR
FT                   AELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRW
FT                   FRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
FT                   QSESAQSKMLSGVGGFVLGLIFLGLGLIIRQRSQKGLLH"
XX
SQ   Sequence 1209 BP; 248 A; 340 C; 334 G; 287 T; 0 other;
     ctttctgcca ggtacatcag atccatcagg tccgagctgt gttgactacc actgcttttc        60
     ccttcgtctc agttatgtct tggaagaagg ctttgcggat ccccggagac cttcgggtag       120
     caactgtcac cttgatgctg gcgatgctga gctccctact ggctgagggc agagactctc       180
     ccgaggattt cgtgttccag tttaagggca tgtgctactt caccaacggg acggagcgcg       240
     tgcgtcttgt gaccagatac atctataacc gagaggagta cgcgcgcttc gacagcgacg       300
     tgggggtgta ccgcgcggtg acgccgcagg ggcggcctga tgccgagtac tggaacagcc       360
     agaaggaagt cctggagggg acccgggcgg agttggacac ggtgtgcaga cacaactacg       420
     aggtggcgtt ccgcgggatc ttgcagagga gagtggagcc cacagtgacc atctccccat       480
     ccaggacaga ggccctcaac caccacaacc tgctggtctg ctcggtgaca gatttctatc       540
     caggccagat caaagtccgg tggtttcgga atgatcagga ggagacagcc ggcgttgtgt       600
     ccacccccct tattaggaat ggtgactgga ctttccagat cctggtgatg ctggaaatga       660
     ctccccagcg tggagatgtc tacacctgcc acgtggagca ccccagcctc cagagcccca       720
     tcaccgtgga gtggcgggct cagtctgaat ctgcccagag caagatgctg agtggcgttg       780
     gaggcttcgt gctggggctg atcttccttg ggctgggcct tatcatccgt caaaggagtc       840
     agaaagggct tctgcactga ctcctgagac tattttaact aggattggtt atcactcttc       900
     tgtgatgcct gcttatgcct gcccagaatt cccagctgcc tgtgtcagct tgtccccctg       960
     agatcaaagt cctacagtgg ctgtcacgca gccaccaggt catctccttt catccccacc      1020
     ccaaggcgct ggctgtgact ctgcttcctg cactgaccca gagcctctgc ctgtgcatgg      1080
     ccagctgcgt ctactcaggt cccaaggggt ttctgtttct attctttcct cagactgctc      1140
     aagagaagca catgaaaaac attacctgac tttagagctt ttttacataa ttaaacatga      1200
     tcctgagtt                                                              1209
//