spacer

EBI Dbfetch

ID   AK316158; SV 1; linear; mRNA; STD; HUM; 970 BP.
XX
AC   AK316158;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA, FLJ79057 complete cds, highly similar to 14-3-3 protein
DE   theta.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-970
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; b3d20abbf71f3fed473cfe6ad1ccc044.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..970
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="FCBBF3"
FT                   /clone="FCBBF3004871"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             386..763
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to 14-3-3 protein theta"
FT                   /db_xref="GOA:B4DY04"
FT                   /db_xref="H-InvDB:HIT000499771.4"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="UniProtKB/TrEMBL:B4DY04"
FT                   /protein_id="BAH14529.1"
FT                   /translation="MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHP
FT                   IRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDN
FT                   LTLWTSDSAGEECDAAEGAEN"
XX
SQ   Sequence 970 BP; 248 A; 249 C; 235 G; 238 T; 0 other;
     gggactcgcg tcgcggccgc ggagacgtga agctctcgag gctcctcccg ctgcgggtcg        60
     gcgctcgccc tcgctctcct cgccctccgc cccggccccg gccccgcgcc cgccatggag       120
     aagactgagc tgatccaacg aggagcgcaa cctgctctcc gtggcctaca agaacgtggt       180
     cgggggccgc aggtccgcct ggagggtcat ctctagcatc gagcagaaga ccgacacctc       240
     cgacaagaag ttgcagctga ttaaggacta tcgggagaaa gtggagtccg agctgagatc       300
     catctgcacc acggtgctgg aattgttgga taaatattta atagccaatg caactaatcc       360
     agagagtaag gtcttctatc tgaaaatgaa gggtgattac ttccggtacc ttgctgaagt       420
     tgcgtgtggt gatgatcgaa aacaaacgat agataattcc caaggagctt accaagaggc       480
     atttgatata agcaagaaag agatgcaacc cacacaccca atccgcctgg ggcttgctct       540
     taacttttct gtattttact atgagattct taataaccca gagcttgcct gcacgctggc       600
     taaaacggct tttgatgagg ccattgctga acttgataca ctgaatgaag actcatacaa       660
     agacagcacc ctcatcatgc agttgcttag agacaaccta acactttgga catcagacag       720
     tgcaggagaa gaatgtgatg cggcagaagg ggctgaaaac taaatccata cagggtgtca       780
     tccttctttc cttcaagaaa cctttttaca catctccatt ccttattcca cttggatttc       840
     ctatagcaaa gaaacccatt catgtgtatg gaatcaactg tttatagtct tttcacactg       900
     cagctttggg aaaacttcat tccttgattt gtgtttgtct tggccttcct ggtgtgcagt       960
     actgctgtag                                                              970
//


spacer
spacer