spacer

EBI Dbfetch

ID   AK314960; SV 1; linear; mRNA; HTC; HUM; 876 BP.
XX
AC   AK314960;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF
DE   superfamily, member 2)(TNF), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-876
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 5517bcc9d16d5f40a9b68cf5fbf21986.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   H-InvDB; HIT000433826_05.4.
DR   H-InvDB; HIT000433826_06.4.
DR   H-InvDB; HIT000433826_07.4.
DR   H-InvDB; HIT000433826_08.4.
DR   H-InvDB; HIT000433826_09.4.
DR   H-InvDB; HIT000433826_10.4.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..876
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NETRP2"
FT                   /clone="NETRP2008342"
FT                   /cell_type="neutrophils"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="primary culture, neutrophils"
FT                   /db_xref="taxon:9606"
FT   CDS             175..876
FT                   /note="Homo sapiens tumor necrosis factor (TNF superfamily,
FT                   member 2)(TNF), mRNA"
FT                   /db_xref="GOA:Q5STB3"
FT                   /db_xref="H-InvDB:HIT000433826_04.4"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5STB3"
FT                   /protein_id="BAG37464.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
XX
SQ   Sequence 876 BP; 186 A; 300 C; 232 G; 158 T; 0 other;
     agacgctccc tcagcaagga cagcagagga ccagctaaga gggagagaag caactacaga        60
     ccccccctga aaacaaccct cagacgccac atcccctgac aagctgccag gcaggttctc       120
     ttcctctcac atactgaccc acggctccac cctctctccc ctggaaagga caccatgagc       180
     actgaaagca tgatccggga cgtggagctg gccgaggagg cgctccccaa gaagacaggg       240
     gggccccagg gctccaggcg gtgcttgttc ctcagcctct tctccttcct gatcgtggca       300
     ggcgccacca cgctcttctg cctgctgcac tttggagtga tcggccccca gagggaagag       360
     ttccccaggg acctctctct aatcagccct ctggcccagg cagtcagatc atcttctcga       420
     accccgagtg acaagcctgt agcccatgtt gtagcaaacc ctcaagctga ggggcagctc       480
     cagtggctga accgccgggc caatgccctc ctggccaatg gcgtggagct gagagataac       540
     cagctggtgg tgccatcaga gggcctgtac ctcatctact cccaggtcct cttcaagggc       600
     caaggctgcc cctccaccca tgtgctcctc acccacacca tcagccgcat cgccgtctcc       660
     taccagacca aggtcaacct cctctctgcc atcaagagcc cctgccagag ggagacccca       720
     gagggggctg aggccaagcc ctggtatgag cccatctatc tgggaggggt cttccagctg       780
     gagaagggtg accgactcag cgctgagatc aatcggcccg actatctcga ctttgccgag       840
     tctgggcagg tctactttgg gatcattgcc ctgtga                                 876
//


spacer
spacer