Dbfetch

ID   AK312000; SV 1; linear; mRNA; HTC; HUM; 628 BP.
XX
AC   AK312000;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ92274, highly similar to Homo sapiens Parkinson
DE   disease (autosomal recessive, early onset) 7 (PARK7), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-628
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 32d57d95b71024d329139db0fa82e144.
DR   Ensembl-Gn; ENSG00000116288; homo_sapiens.
DR   Ensembl-Tr; ENST00000338639; homo_sapiens.
DR   Ensembl-Tr; ENST00000377488; homo_sapiens.
DR   Ensembl-Tr; ENST00000377491; homo_sapiens.
DR   Ensembl-Tr; ENST00000493373; homo_sapiens.
DR   Ensembl-Tr; ENST00000493678; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..628
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRTHA2"
FT                   /clone="BRTHA2033267"
FT                   /tissue_type="thalamus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             59..628
FT                   /note="highly similar to Homo sapiens Parkinson disease
FT                   (autosomal recessive, early onset) 7 (PARK7), mRNA"
FT                   /db_xref="GOA:Q99497"
FT                   /db_xref="H-InvDB:HIT000430866.6"
FT                   /db_xref="HGNC:HGNC:16369"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1J42"
FT                   /db_xref="PDB:1P5F"
FT                   /db_xref="PDB:1PDV"
FT                   /db_xref="PDB:1PDW"
FT                   /db_xref="PDB:1PE0"
FT                   /db_xref="PDB:1Q2U"
FT                   /db_xref="PDB:1SOA"
FT                   /db_xref="PDB:1UCF"
FT                   /db_xref="PDB:2OR3"
FT                   /db_xref="PDB:2R1T"
FT                   /db_xref="PDB:2R1U"
FT                   /db_xref="PDB:2R1V"
FT                   /db_xref="PDB:2RK3"
FT                   /db_xref="PDB:2RK4"
FT                   /db_xref="PDB:2RK6"
FT                   /db_xref="PDB:3B36"
FT                   /db_xref="PDB:3B38"
FT                   /db_xref="PDB:3B3A"
FT                   /db_xref="PDB:3BWE"
FT                   /db_xref="PDB:3CY6"
FT                   /db_xref="PDB:3CYF"
FT                   /db_xref="PDB:3CZ9"
FT                   /db_xref="PDB:3CZA"
FT                   /db_xref="PDB:3EZG"
FT                   /db_xref="PDB:3F71"
FT                   /db_xref="PDB:3SF8"
FT                   /db_xref="PDB:4BTE"
FT                   /db_xref="PDB:4MNT"
FT                   /db_xref="PDB:4MTC"
FT                   /db_xref="PDB:4N0M"
FT                   /db_xref="PDB:4N12"
FT                   /db_xref="PDB:4OGF"
FT                   /db_xref="PDB:4OQ4"
FT                   /db_xref="PDB:4P2G"
FT                   /db_xref="PDB:4P34"
FT                   /db_xref="PDB:4P35"
FT                   /db_xref="PDB:4P36"
FT                   /db_xref="PDB:4RKW"
FT                   /db_xref="PDB:4RKY"
FT                   /db_xref="PDB:4S0Z"
FT                   /db_xref="PDB:4ZGG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99497"
FT                   /protein_id="BAG34938.1"
FT                   /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQ
FT                   CSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAA
FT                   ICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFE
FT                   FALAIVEALNGKEVAAQVKAPLVLKD"
XX
SQ   Sequence 628 BP; 168 A; 126 C; 184 G; 150 T; 0 other;
     gtgctggcgt gcgttcattt tcagcctggt gtggggcttg taaacatata acataaaaat        60
     ggcttccaaa agagctctgg tcatcctggc taaaggagca gaggaaatgg agacggtcat       120
     ccctgtagat gtcatgaggc gagctgggat taaggtcacc gttgcaggcc tggctggaaa       180
     agacccagta cagtgtagcc gtgatgtggt catttgtcct gatgccagcc ttgaagatgc       240
     aaaaaaagag ggaccatatg atgtggtggt tctaccagga ggtaatctgg gcgcacagaa       300
     tttatctgag tctgctgctg tgaaggagat actgaaggag caggaaaacc ggaagggcct       360
     gatagccgcc atctgtgcag gtcctactgc tctgttggct catgaaatag gttttggaag       420
     taaagttaca acacaccctc ttgctaaaga caaaatgatg aatggaggtc attacaccta       480
     ctctgagaat cgtgtggaaa aagacggcct gattcttaca agccgggggc ctgggaccag       540
     cttcgagttt gcgcttgcaa ttgttgaagc cctgaatggc aaggaggtgg cggctcaagt       600
     gaaggctcca cttgttctta aagactag                                          628
//