spacer

EBI Dbfetch

ID   AK302208; SV 1; linear; mRNA; STD; HUM; 1232 BP.
XX
AC   AK302208;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ51144 complete cds, highly similar to 14-3-3 protein
DE   theta.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1232
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; d863561015719cfcabcdff5fccd6a3eb.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1232
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TESTI2"
FT                   /clone="TESTI2038931"
FT                   /tissue_type="testis"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             264..641
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to 14-3-3 protein theta"
FT                   /db_xref="GOA:B4DY04"
FT                   /db_xref="H-InvDB:HIT000496832.4"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="UniProtKB/TrEMBL:B4DY04"
FT                   /protein_id="BAG63566.1"
FT                   /translation="MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHP
FT                   IRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDN
FT                   LTLWTSDSAGEECDAAEGAEN"
XX
SQ   Sequence 1232 BP; 362 A; 257 C; 262 G; 351 T; 0 other;
     aaaagccaaa agcagatcaa agtggtggga ctcgcgtcgc ggcctacaag aacgtggtcg        60
     ggggccgcag gtccgcctgg agggtcatct ctagcatcga gcagaagacc gacacctccg       120
     acaagaagtt gcagctgatt aaggactatc gggagaaagt ggagtccgag ctgagatcca       180
     tctgcaccac ggtgctggaa ttgttggata aatatttaat agccaatgca actaatccag       240
     agagtaaggt cttctatctg aaaatgaagg gtgattactt ccggtacctt gctgaagttg       300
     cgtgtggtga tgatcgaaaa caaacgatag ataattccca aggagcttac caagaggcat       360
     ttgatataag caagaaagag atgcaaccca cacacccaat ccgcctgggg cttgctctta       420
     acttttctgt attttactat gagattctta ataacccaga gcttgcctgc acgctggcta       480
     aaacggcttt tgatgaggcc attgctgaac ttgatacact gaatgaagac tcatacaaag       540
     acagcaccct catcatgcag ttgcttagag acaacctaac actttggaca tcagacagtg       600
     caggagaaga atgtgatgcg gcagaagggg ctgaaaacta aatccataca gggtgtcatc       660
     cttctttcct tcaagaaacc tttttacaca tctccattcc ttattccact tggatttcct       720
     atagcaaaga aacccattca tgtgtatgga atcaactgtt tatagtcttt tcacactgca       780
     gctttgggaa aacttcattc cttgatttgt gtttgtcttg gccttcctgg tgtgcagtac       840
     tgctgtagaa aagtattaat agcttcattt catataaaca taagtaactc ccaaacactt       900
     atgtagagga ctaaaaatgt atctggtatt taagtaatct gaaccagttc tgcaagtgac       960
     tgtgttttgt attactgtga aaataagaaa atgtagttaa ttacaattta aagagtattc      1020
     cacataactt cttaatttct acattccctc ccttactctt cgggggtttc ctttcagtaa      1080
     gcaacttttc catgctctta atgtattcct ttttagtagg aatccggaag tattagattg      1140
     aatggaaaag cacttgccat ctctgtctag gggtcacaaa ttgaaatggc tcctgtatca      1200
     catacggagg tcttgtgtat ctgtggcaac ag                                    1232
//


spacer
spacer