Dbfetch

ID   AK299395; SV 1; linear; mRNA; STD; HUM; 2373 BP.
XX
AC   AK299395;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ58750 complete cds, highly similar to Carnitine
DE   O-palmitoyltransferase I, muscle isoform (EC 2.3.1.21).
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2373
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; d120c58ee11f4277a5fb2a7d353bee97.
DR   Ensembl-Gn; ENSG00000205560; homo_sapiens.
DR   Ensembl-Tr; ENST00000312108; homo_sapiens.
DR   Ensembl-Tr; ENST00000360719; homo_sapiens.
DR   Ensembl-Tr; ENST00000395650; homo_sapiens.
DR   Ensembl-Tr; ENST00000405237; homo_sapiens.
DR   Ensembl-Tr; ENST00000457250; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2373
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NTONG2"
FT                   /clone="NTONG2002140"
FT                   /tissue_type="tongue"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             76..2151
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Carnitine O-palmitoyltransferase
FT                   I, muscle isoform (EC 2.3.1.21)"
FT                   /db_xref="GOA:Q92523"
FT                   /db_xref="H-InvDB:HIT000494019.4"
FT                   /db_xref="HGNC:HGNC:2329"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR032476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92523"
FT                   /protein_id="BAH13024.1"
FT                   /translation="MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIR
FT                   IKNGILRGVYPGSPTSWLVVIMATVGSSFSNVDISLGLVSCIQRCLPQGCGPYQTPQTR
FT                   ALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRH
FT                   PMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKY
FT                   LVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAM
FT                   IMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHK
FT                   GRFFKLWLYEGARLLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
FT                   IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIKSSYQVAKA
FT                   LADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFR
FT                   EGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHL
FT                   FCLYLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVA
FT                   DDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS"
XX
SQ   Sequence 2373 BP; 518 A; 711 C; 634 G; 510 T; 0 other;
     gagcaacctt caccgcacag aaacccagcc gcgccctgca attcccaccg cggaaggtgc        60
     cgaccaaccc ccaggatggc ggaagctcac caggccgtgg ccttccagtt cacggtgacc       120
     ccagacgggg tcgacttccg gctcagtcgg gaggccctga aacacgtcta cctgtctggg       180
     atcaactcct ggaagaaacg cctgatccgc atcaagaatg gcatcctcag gggcgtgtac       240
     cctggcagcc ccaccagctg gctggtcgtc atcatggcaa cagtgggttc ctccttcagc       300
     aacgtggaca tctccttggg gctggtcagt tgcatccaga gatgcctccc tcaggggtgt       360
     ggcccctacc agaccccgca gacccgggca cttctcagca tggccatctt ctccacgggc       420
     gtctgggtga cgggcatctt cttcttccgc caaaccctga agctgcttct ctgctaccat       480
     gggtggatgt ttgagatgca tggcaagacc agcaacttga ccaggatctg ggctatgtgt       540
     atccgccttc tatccagccg gcaccctatg ctctacagct tccagacatc tctgcccaag       600
     cttcctgtgc ccagggtgtc agccacaatt cagcggtacc tagagtctgt gcgccccttg       660
     ttggatgatg aggaatatta ccgcatggag ttgctggcca aagaattcca ggacaagact       720
     gcccccaggc tgcagaaata cctggtgctc aagtcatggt gggcaagtaa ctatgtgagt       780
     gactggtggg aagagtacat ctaccttcga ggcaggagcc ctctcatggt gaacagcaac       840
     tattatgtca tggaccttgt gctcatcaag aatacagacg tgcaggcagc ccgcctggga       900
     aacatcatcc acgccatgat catgtatcgc cgtaaactgg accgtgaaga aatcaagcct       960
     gtgatggcac tgggcatagt gcctatgtgc tcctaccaga tggagaggat gttcaacacc      1020
     actcggatcc cgggcaagga cacagatgtg ctacagcacc tctcagacag ccggcacgtg      1080
     gctgtctacc acaagggacg cttcttcaag ctgtggctct atgagggcgc ccgtctgctc      1140
     agcctctatg gcaaggccct gctacatggc aactgctaca acaggtggtt tgacaaatcc      1200
     ttcactctca tttccttcaa gaatggccag ttgggtctca atgcagagca tgcgtgggca      1260
     gatgctccca tcattgggca cctctgggag tttgtcctgg gcacagacag cttccacctg      1320
     ggctacacgg agaccgggca ctgcctgggc aaaccgaacc ctgcgctcgc acctcctaca      1380
     cggctgcagt gggacattcc aaaacagtgc caggcggtca tcaagagttc ctaccaggtg      1440
     gccaaggcgt tggcagacga cgtggagttg tactgcttcc agttcctgcc ctttggcaaa      1500
     ggcctcatca agaagtgccg gaccagccct gatgcctttg tgcagatcgc gctgcagctg      1560
     gctcacttcc gggacagggg taagttctgc ctgacctatg aggcctcaat gaccagaatg      1620
     ttccgggagg gacggactga gactgtgcgt tcctgtacca gcgagtccac agcctttgtg      1680
     caggccatga tggaggggtc ccacacaaaa gcagacctgc gagatctctt ccagaaggct      1740
     gctaagaagc accagaatat gtaccgcctg gccatgaccg gggcagggat cgacaggcac      1800
     ctcttctgcc tttacttggt ctccaagtac ctaggagtca gctctccttt ccttgctgag      1860
     gtgctctcgg aaccctggcg tctctccacc agccagatcc cccaatccca gatccgcatg      1920
     ttcgacccag agcagcaccc caatcacctg ggcgctggag gtggctttgg ccctgtagca      1980
     gatgatggct atggagtttc ctacatgatt gcaggcgaga acacgatctt cttccacatc      2040
     tccagcaagt tctcaagctc agagacgaac gcccagcgct ttggaaacca catccgcaaa      2100
     gccctgctgg acattgctga tcttttccaa gttcccaagg cctacagctg aagcccttag      2160
     gtacctgtgt tttgtttggg aactcggagg ccctccccct cccccagctc agaccacaga      2220
     ggtggcaaga gaagggctga agctggaaga ctgttcatga gggacttgtg tgacctgctt      2280
     tgaaatgtgt gactctgctg agtgacgtag gctctgagat agctgtccac gcccacgtgt      2340
     ttgcttggaa taaatacttg cctcagaacc ttc                                   2373
//