spacer

EBI Dbfetch

ID   AK297866; SV 1; linear; mRNA; STD; HUM; 2489 BP.
XX
AC   AK297866;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ55729 complete cds, highly similar to Carnitine
DE   O-palmitoyltransferase I, muscle isoform (EC 2.3.1.21).
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2489
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; bbdac96eec55d33bf47bc1f545e84b3c.
DR   Ensembl-Gn; ENSG00000205560; homo_sapiens.
DR   Ensembl-Tr; ENST00000312108; homo_sapiens.
DR   Ensembl-Tr; ENST00000360719; homo_sapiens.
DR   Ensembl-Tr; ENST00000395650; homo_sapiens.
DR   Ensembl-Tr; ENST00000405237; homo_sapiens.
DR   Ensembl-Tr; ENST00000457250; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2489
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="HEART2"
FT                   /clone="HEART2006953"
FT                   /tissue_type="heart"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             51..2267
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Carnitine O-palmitoyltransferase
FT                   I, muscle isoform (EC 2.3.1.21)"
FT                   /db_xref="GOA:Q92523"
FT                   /db_xref="H-InvDB:HIT000492490.4"
FT                   /db_xref="HGNC:HGNC:2329"
FT                   /db_xref="InterPro:IPR000542"
FT                   /protein_id="BAH12680.1"
FT                   /translation="MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIR
FT                   IKNGILRGVYPGSPTSWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTR
FT                   ALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAYLESVRPLLD
FT                   DEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNY
FT                   YVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALGIVPMCSYQMERMFNT
FT                   TRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPP
FT                   QPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDE
FT                   ASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTD
FT                   SFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKALADDVELYCFQF
FT                   LPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTS
FT                   ESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGV
FT                   SSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGYGVSYMIAG
FT                   ENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS"
XX
SQ   Sequence 2489 BP; 540 A; 735 C; 686 G; 528 T; 0 other;
     cagccgcgcc ctgcaattcc caccgcggaa ggtgccgacc aacccccagg atggcggaag        60
     ctcaccaggc cgtggccttc cagttcacgg tgaccccaga cggggtcgac ttccggctca       120
     gtcgggaggc cctgaaacac gtctacctgt ctgggatcaa ctcctggaag aaacgcctga       180
     tccgcatcaa gaatggcatc ctcaggggcg tgtaccctgg cagccccacc agctggctgg       240
     tcgtcatcat ggcaacagtg ggttcctcct tctgcaacgt ggacatctcc ttggggctgg       300
     tcagttgcat ccagagatgc ctccctcagg ggtgtggccc ctaccagacc ccgcagaccc       360
     gggcacttct cagcatggcc atcttctcca cgggcgtctg ggtgacgggc atcttcttct       420
     tccgccaaac cctgaagctg cttctctgct accatgggtg gatgtttgag atgcatggca       480
     agaccagcaa cttgaccagg atctgggctt acctagagtc tgtgcgcccc ttgttggatg       540
     atgaggaata ttaccgcatg gagttgctgg ccaaagaatt ccaggacaag actgccccca       600
     ggctgcagaa atacctggtg ctcaagtcat ggtgggcaag taactatgtg agtgactggt       660
     gggaagagta catctacctt cgaggcagga gccctctcat ggtgaacagc aactattatg       720
     tcatggacct tgtgctcatc aagaatacag acgtgcaggc agcccgcctg ggaaacatca       780
     tccacgccat gatcatgtat cgccgtaaac tggaccgtga agaaatcaag cctgtgatgg       840
     cactgggcat agtgcctatg tgctcctacc agatggagag gatgttcaac accactcgga       900
     tcccgggcaa ggacacagat gtgctacagc acctctcaga cagccggcac gtggctgtct       960
     accacaaggg acgcttcttc aagctgtggc tctatgaggg cgcccgtctg ctcaagcctc      1020
     aggatctgga gatgcagttc cagaggatcc tggacgaccc ctccccacct cagcctgggg      1080
     aggagaagct ggcagccctc actgcaggag gaagggtgga gtgggcgcag gcacgccagg      1140
     ccttctttag ctctggaaag aataaggctg ccttggaggc catcgagcgt gccgctttct      1200
     tcgtggccct ggatgaggaa tcctactcct atgaccccga agatgaggcc agcctcagcc      1260
     tctatggcaa ggccctgcta catggcaact gctacaacag gtggtttgac aaatccttca      1320
     ctctcatttc cttcaagaat ggccagttgg gtctcaatgc agagcatgcg tgggcagatg      1380
     ctcccatcat tgggcacctc tgggagtttg tcctgggcac agacagcttc cacctgggct      1440
     acacggagac cgggcactgc ctgggcaaac cgaaccctgc gctcgcacct cctacacggc      1500
     tgcagtggga cattccaaaa cagtgccagg cggtcatcga gagttcctac caggtggcca      1560
     aggcgttggc agacgacgtg gagttgtact gcttccagtt cctgcccttt ggcaaaggcc      1620
     tcatcaagaa gtgccggacc agccctgatg cctttgtgca gatcgcgctg cagctggctc      1680
     acttccggga caggggtaag ttctgcctga cctatgaggc ctcaatgacc agaatgttcc      1740
     gggagggacg gactgagact gtgcgttcct gtaccagcga gtccacagcc tttgtgcagg      1800
     ccatgatgga ggggtcccac acaaaagcag acctgcgaga tctcttccag aaggctgcta      1860
     agaagcacca gaatatgtac cgcctggcca tgaccggggc agggatcgac aggcacctct      1920
     tctgccttta cttggtctcc aagtacctag gagtcagctc tcctttcctt gctgaggtgc      1980
     tctcggaacc ctggcgtctc tccaccagcc agatccccca atcccagatc cgcatgttcg      2040
     acccagagca gcaccccaat cacctgggcg ctggaggtgg ctttggccct gtagcagatg      2100
     atggctatgg agtttcctac atgattgcag gcgagaacac gatcttcttc cacatctcca      2160
     gcaagttctc aagctcagag acgaacgccc agcgctttgg aaaccacatc cgcaaagccc      2220
     tgctggacat tgctgatctt ttccaagttc ccaaggccta cagctgaagc ccttaggtac      2280
     ctgtgttttg tttgggaact cggaggccct ccccctcccc cagctcaaac cacagaggtg      2340
     gcaagagaag ggctgaagct ggaagactgt tcatgaggga cttgtgtgac ctgctttgaa      2400
     atgtgtgact ctgctgagtg acgtaggctc tgagatagct gtccacgccc acgtgtttgc      2460
     ttggaataaa tacttgcctc agaaccttc                                        2489
//


spacer
spacer