spacer

EBI Dbfetch

ID   AK293020; SV 1; linear; mRNA; STD; HUM; 1458 BP.
XX
AC   AK293020;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ75018 complete cds.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1458
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; afbef91f8d99f4e2b01c614766607e62.
DR   H-InvDB; HIT000425817_04.4.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1458
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TUTER2"
FT                   /clone="TUTER2002426"
FT                   /tissue_type="uterus, tumor tissue"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="tumor tissue"
FT                   /db_xref="taxon:9606"
FT   CDS             105..905
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="H-InvDB:HIT000425817_03.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="BAF85709.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAV
FT                   DTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
XX
SQ   Sequence 1458 BP; 357 A; 355 C; 379 G; 367 T; 0 other;
     taacttactc cctataactt ggaatgtggg tggaggggtt catagttctc cctgagtgag        60
     acttgcctgc tgctctggcc cctggtcctg tcctgttctc cagcatggtg tgtctgaggc       120
     tccctggagg ctcctgcatg gcagttctga cagtgacact gatggtgctg agctccccac       180
     tggctttggc tggggacacc agaccacgtt tcttggagta ctctacgtct gagtgtcatt       240
     tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttccataac caggaggaga       300
     acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg gggcggcctg       360
     atgccgagta ctggaacagc cagaaggaca tcctggaaga cgagcgggcc gcggtggaca       420
     cctactgcag acacaactac ggggttgtgg agagcttcac agtgcagcgg cgagtccatc       480
     ctaaggtgac tgtgtatcct tcaaagaccc agcccctgca gcaccacaac ctcctggtct       540
     gttctgtgag tggtttctat ccaggcagca ttgaagtcag gtggttccgg aatggccagg       600
     aagagaagac tggggtggtg tccacaggcc tgatccacaa tggagactgg accttccaga       660
     ccctggtgat gctggaaaca gttcctcgga gtggagaggt ttacacctgc caagtggagc       720
     acccaagcgt gacaagccct ctcacagtgg aatggagagc acggtctgaa tctgcacaga       780
     gcaagatgct gagtggagtc gggggctttg tgctgggcct gctcttcctt ggggccgggc       840
     tgttcatcta cttcaggaat cagaaaggac actctggact tcagccaaga ggattcctga       900
     gctgaagtgc agatgacaca ttcaaagaag aactttctgc cccagctttg caggatgaaa       960
     agctttccct cctggctgtt attcttccac aagagagggc tttctcagga cctggttgct      1020
     actggttcag caactgcaga aaatgtcctc ccttgtggct tcctcagctc ctgttcttgg      1080
     cctgaagccc cacagctttg atggcagcgc ctcatcttca acttttgtgc tcccctttgc      1140
     ctaaacccta tggcctcctg tgcatctgta ctcaccctgt accacaaaca cattacatta      1200
     ttaaatgttt ctcaaagatg gagttaaata tcatctggtc catttggctc caaagacaaa      1260
     aaatgaaaag aaaagaaaaa gggaaggaag attatttccc aatagaataa tgattttcat      1320
     gtatatgtca tgagtatgtg aggtaatgca tatgtaaaat aacttgattt agacattcca      1380
     cactataggc atatatcaaa acttcattct gtacaatata aatacactat acaattttta      1440
     cttgtcaatc aaaaaagt                                                    1458
//


spacer
spacer