spacer

EBI Dbfetch

ID   AK291987; SV 1; linear; mRNA; STD; HUM; 1228 BP.
XX
AC   AK291987;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ75017 complete cds, highly similar to Homo sapiens
DE   major histocompatibility complex, class II, DR beta 1, mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1228
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; f38ee464763d82e604ddcf7af2a4d18b.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1228
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="SMINT2"
FT                   /clone="SMINT2010715"
FT                   /tissue_type="small intestine"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             95..895
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens major
FT                   histocompatibility complex, class II, DR beta 1, mRNA"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="H-InvDB:HIT000424784.6"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="BAF84676.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQPKRECH
FT                   FFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAV
FT                   DTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLN
FT                   GQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 1228 BP; 263 A; 323 C; 350 G; 292 T; 0 other;
     cctataactt ggaatgtggg tggaggggtt catagttctc cctgagtgag acttgcctgc        60
     ttctctggcc cctggtcctg tcctgttctc cagcatggtg tgtctgaagc tccctggagg       120
     ctcctgcatg acagcgctga cagtgacact gatggtgctg agctccccac tggctttggc       180
     tggggacacc cgaccacgtt tcctgtggca gcctaagagg gagtgtcatt tcttcaatgg       240
     gacggagcgg gtgcggttcc tggacagata cttctataac caggaggagt ccgtgcgctt       300
     cgacagcgac gtgggggagt accgggcggt gacggagctg gggcggcctg acgctgagta       360
     ctggaacagc cagaaggact tcctggaaga caggcgcgcc gcggtggaca cctactgcag       420
     acacaactac ggggttggtg agagcttcac agtgcagcgg cgagtccaac ctaaggtgac       480
     tgtatatcct tcaaagaccc agcccctgca gcaccacaac ctcctggtct gctctgtgag       540
     tggtttctat ccaggcagca ttgaagtcag gtggttcctg aacggccagg aagagaaggc       600
     tgggatggtg tccacaggcc tgatccagaa tggagactgg accttccaga ccctggtgat       660
     gctggaaaca gttcctcgaa gtggagaggt ttacacctgc caagtggagc acccaagcgt       720
     gacaagccct ctcacagtgg aatggagagc acggtctgaa tctgcacaga gcaagatgct       780
     gagtggagtc gggggctttg tgctgggcct gctcttcctt ggggccgggc tgttcatcta       840
     cttcaggaat cagaaaggac actctggact tcagccaaca ggattcctga gctgaaatgc       900
     agatgaccac attcaaggaa gaactttctg ccccggcttt gcaggatgaa aagctttcct       960
     gcttggcagt tattcttcca caagagaggg ctttctcagg acctggttgc tactggttcg      1020
     gcaactgcag aaaatgtcct cccttgtggc ttcctcagct cctgcccttg gcctgaagtc      1080
     ccagcattga tggcagcgcc tcatcttcaa cttttgtgct cccctttgcc taaaccgtat      1140
     ggcctcccgt gcatctgtat tcaccctgta tgacaaacac attacattat taaatgtttc      1200
     tcaaagatgg agttaaatat catctggt                                         1228
//


spacer
spacer