spacer

EBI Dbfetch

ID   AK290210; SV 1; linear; mRNA; STD; HUM; 3807 BP.
XX
AC   AK290210;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ78422 complete cds, highly similar to Homo sapiens
DE   putative N-ATPase mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3807
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 08527d5b3e8ce2381e0cd8503bd3c007.
DR   Ensembl-Gn; ENSG00000159363; homo_sapiens.
DR   Ensembl-Tr; ENST00000326735; homo_sapiens.
DR   Ensembl-Tr; ENST00000341676; homo_sapiens.
DR   Ensembl-Tr; ENST00000452699; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3807
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRTHA3"
FT                   /clone="BRTHA3018177"
FT                   /tissue_type="thalamus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             191..3718
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens putative N-ATPase
FT                   mRNA"
FT                   /db_xref="GOA:Q9NQ11"
FT                   /db_xref="H-InvDB:HIT000423007.6"
FT                   /db_xref="HGNC:HGNC:30213"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
FT                   /protein_id="BAF82899.1"
FT                   /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPW
FT                   RVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFT
FT                   VQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLF
FT                   QGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKS
FT                   YPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLR
FT                   DMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSL
FT                   TGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAK
FT                   GGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALD
FT                   LVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDG
FT                   LDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVEST
FT                   GWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVV
FT                   VAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVP
FT                   SLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAV
FT                   TVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASYTVEPD
FT                   PRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAPEQKTELVCELQKLQYCVGMC
FT                   GDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPMVIREGRCSLDTSFSVFK
FT                   YMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALVLGRVRPPG
FT                   ALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVAAPDNLPNYENTVVFSL
FT                   SSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALLSSVLVGLVLVPGLLQGPLALRNIT
FT                   DTGFKLLLLGLVTLNFVGAFMLESVLDQCLPACLRRLRPKRASKKRFKQLERELAEQPW
FT                   PPLPAGPLR"
XX
SQ   Sequence 3807 BP; 663 A; 1283 C; 1167 G; 694 T; 0 other;
     agtgtcggag ccgcgccgag cctggtggcc caggtgcccc gcccgcgtca gccctgctcc        60
     agccccgcgc tagcccagcg cccctcgccc cgggccgtcc ggaccgcgcc cccgcccagg       120
     gccttgcgca cgccggggcc caggccgagg gccgcagcgc cggggccggc gatgagcgcg       180
     aggagccggc atgagcgcag acagcagccc tctcgtgggc agcacgccca ccggttatgg       240
     gaccctgacg atagggacat caatagatcc cctcagctcc tcagtttcat ccgtgaggct       300
     cagcggctac tgtggcagtc catggagggt catcggctat cacgtcgtgg tctggatgat       360
     ggctgggatc cctttgctgc tcttccgttg gaagcccctg tggggggtgc ggctgcggct       420
     ccggccctgc aacctggccc acgccgaaac actcgttatc gaaataagag acaaagagga       480
     tagttcctgg cagctcttca ctgtccaggt gcagactgag gccatcggcg agggcagcct       540
     ggagccgtcc ccacagtccc aggcagagga tggccggagc caggcggcag ttggggcggt       600
     accagagggt gcctggaagg atacggccca gctccacaag agcgaggagg cgaagcgggt       660
     gctgcggtat tacctcttcc agggccagcg ctatatctgg atcgagaccc agcaagcctt       720
     ctaccaggtc agcctcctgg accatggccg ctcttgtgac gacgtccacc gctcccgcca       780
     tggcctcagc ctccaggacc aaatggtgag gaaggccatt tacggcccca acgtgatcag       840
     cataccggtc aagtcctacc cccagctgct ggtggacgag gcactgaacc cctactatgg       900
     gttccaggcc ttcagcatcg cgctgtggct ggctgaccac tactactggt acgccctgtg       960
     catcttcctc atttcctcca tctccatctg cctgtcgctg tacaagacca gaaagcaaag      1020
     ccagactcta agggacatgg tcaagttgtc catgcgggtg tgcgtgtgcc ggccaggggg      1080
     agaggaagag tgggtggact ccagtgagct agtgcccgga gactgcctgg tgctgcccca      1140
     ggagggtggg ctgatgccct gtgatgccgc cctggtggcc ggcgagtgca tggtgaatga      1200
     gagctctctg acaggagaga gcattccagt gctgaagacg gcactgccgg aggggctggg      1260
     gccctactgt gcagagacac accggcggca cacactcttc tgcgggaccc tcatcttgca      1320
     ggcccgggcc tatgtgggac cgcacgtcct ggcagtggtg acccgcacag ggttctgcac      1380
     ggcaaaaggg ggcctggtga gctccatctt gcacccccgg cccatcaact tcaagttcta      1440
     taaacacagc atgaagtttg tggctgccct ctctgtcctg gctctcctcg gcaccatcta      1500
     cagcatcttc atcctctacc gaaaccgggt gcctctgaat gagattgtaa tccgggctct      1560
     cgacctggtg accgtggtgg tgccacctgc cctgcctgct gccatgactg tgtgcacgct      1620
     ctacgcccag agccgactgc ggagacaggg cattttctgc atccacccac tgcgcatcaa      1680
     cctggggggc aagctgcagc tggtgtgttt cgacaagacg ggcaccctca ctgaggacgg      1740
     cttagacgtg atgggggtgg tgcccctgaa ggggcaggca ttcctgcccc tggtcccaga      1800
     gcctcgccgc ctgcctgtgg ggcccctgct ccgagcactg gccacctgcc atgccctcag      1860
     ccggctccag gacacccccg tgggcgaccc catggacttg aagatggtgg agtctactgg      1920
     ctgggtcctg gaggaagagc cggctgcaga ctcagcattt gggacccagg tcttggcagt      1980
     gatgagacct ccactttggg agccccagct gcaggcaatg gaggagcccc cggtgccagt      2040
     cagcgtcctc caccgcttcc ccttctcttc ggctctgcag cgcatgagtg tggtggtggc      2100
     gtggccaggg gccactcagc ccgaggccta cgtcaaaggc tccccggagc tggtggcagg      2160
     gctctgcaac cccgagacag tgcccaccga cttcgcccag atgctgcaga gctatacagc      2220
     tgctggctac cgtgtcgtgg ccctggccag caagccactg cccactgtgc ccagcctgga      2280
     ggcagcccag caactgacga gggacactgt ggaaggagac ctgagcctcc tggggctgct      2340
     ggtcatgagg aacctactga agccgcagac aacgccagtt atccaggctc tgcgaaggac      2400
     ccgcatccgc gccgtcatgg tgacagggga caacctgcag acagcggtga ctgtggcccg      2460
     gggctgtggc atggtggccc cccaggagca tctgatcatc gtccacgcca cccaccctga      2520
     gcggggtcag cctgcctctc tcgagttcct gccgatggag tcccccacag ccgtgaatgg      2580
     cgttaaggat cctgaccagg ctgcaagcta caccgtggag ccagaccccc gatccaggca      2640
     cctggccctc agcgggccca cctttggtat cattgtgaag cacttcccca agctgctgcc      2700
     caaggtcctg gtccagggca ctgtctttgc ccgcatggcc cctgagcaga agacagagct      2760
     ggtgtgcgag ctacagaagc ttcagtactg cgtgggcatg tgcggagacg gtgccaatga      2820
     ctgtggggcc ctgaaggcgg ctgatgtcgg catctcgctg tcccaggcag aagcctcagt      2880
     ggtctcaccc ttcacctcga gcatggccag tattgagtgc gtgcccatgg tcatcaggga      2940
     ggggcgctgt tcccttgaca cttcgttcag cgtcttcaag tacatggctc tgtacagcct      3000
     gacccagttc atctccgtcc tgatcctcta cacgatcaac accaacctgg gtgacctgca      3060
     gttcctggcc atcgacctgg tcatcaccac cacagtggca gtgctcatga gccgcacggg      3120
     gccagcgctg gtcctgggac gggtacggcc accgggggcg ctgctcagcg tgcccgtgct      3180
     cagcagcctg ctgctgcaga tggtcctggt gaccggcgtg cagctagggg gctacttcct      3240
     gaccctggcc cagccatggt tcgtgcctct gaacaggaca gtggccgcac cagacaacct      3300
     gcccaactac gagaacaccg tggtcttctc tctgtccagc ttccagtacc tcatcctggc      3360
     tgcagctgtg tccaaggggg cgcccttccg ccggccgctc tacaccaatg tgcccttcct      3420
     ggtggccctg gcgctcctga gctccgtcct ggtgggcctt gtcctggtcc ccggcctcct      3480
     gcaggggccg ctggcgctga ggaacatcac tgacaccggc ttcaagctgc tgctgctggg      3540
     tctggtcacc ctcaacttcg tgggggcctt catgctggag agcgtgctag accagtgcct      3600
     ccccgcctgc ctgcgccgcc tccggcccaa gcgggcctcc aagaagcgct tcaagcagct      3660
     ggaacgagag ctggccgagc agccctggcc accgctgccc gccggccccc tgaggtagtg      3720
     caggcccacg ggcaccccag acactggaac tccctgcctc tgagccacca actggacccc      3780
     tctccagcaa caccaccgcc accacct                                          3807
//


spacer
spacer