spacer

EBI Dbfetch

ID   AK290169; SV 1; linear; mRNA; STD; HUM; 602 BP.
XX
AC   AK290169;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ76529 complete cds, highly similar to Homo sapiens
DE   synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript
DE   variant NACP140, mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-602
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 068fa9a8e025fbba142c40673f6b24a1.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..602
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRTHA3"
FT                   /clone="BRTHA3004508"
FT                   /tissue_type="thalamus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             85..507
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens synuclein, alpha (non
FT                   A4 component of amyloid precursor) (SNCA), transcript
FT                   variant NACP140, mRNA"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000422966.5"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="PDB:4BXL"
FT                   /protein_id="BAF82858.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNE
FT                   EGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA"
XX
SQ   Sequence 602 BP; 176 A; 118 C; 182 G; 126 T; 0 other;
     aagccttctg cctttccacc ctcgtgagcg gagaactggg agtggccatt cgacgacagt        60
     gtggtgtaaa ggaattcatt agccatggat gtattcatga aaggactttc aaaggccaag       120
     gagggagttg tggctgctgc tgagaaaacc aaacagggtg tggcagaagc agcaggaaag       180
     acaaaagagg gtgttctcta tgtaggctcc aaaaccaagg agggagtggt gcatggtgtg       240
     gcaacagtgg ctgagaagac caaagagcaa gtgacaaatg ttggaggagc agtggtgacg       300
     ggtgtgacag cagtagccca gaagacagtg gagggagcag ggagcattgc agcagccact       360
     ggctttgtca aaaaggacca gttgggcaag aatgaagaag gagccccaca ggaaggaatt       420
     ctggaagata tgcctgtgga tcctgacaat gaggcttatg aaatgccttc tgaggaaggg       480
     tatcaagact acgaacctga agcctaagaa atatctttgc tcccagtttc ttgagatctg       540
     ctgacagatg ttccatcctg tacaagtgct cagttccaat gtgcccagtc atgacatttc       600
     tc                                                                      602
//


spacer
spacer