spacer

EBI Dbfetch

ID   AK289463; SV 1; linear; mRNA; STD; HUM; 999 BP.
XX
AC   AK289463;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ78355 complete cds, highly similar to Homo sapiens
DE   major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-999
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 34c10a28211510b418709149910f7cfa.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..999
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRACE2"
FT                   /clone="BRACE2002819"
FT                   /tissue_type="cerebellum"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             64..864
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens major
FT                   histocompatibility complex, class II, DR beta 1 (HLA-DRB1),
FT                   mRNA"
FT                   /db_xref="GOA:P04229"
FT                   /db_xref="H-InvDB:HIT000422260.6"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04229"
FT                   /protein_id="BAF82152.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECH
FT                   FFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAV
FT                   DTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 999 BP; 211 A; 255 C; 309 G; 224 T; 0 other;
     atagttctcc ctgagtgaga cttgcctgct tctctggccc ctggtcctgt cctgttctcc        60
     agcatggtgt gtctgaagct ccctggaggc tcctgcatga cagcgctgac agtgacactg       120
     atggtgctga gctccccact ggctttggct ggggacaccc gaccacgttt cttgtggcag       180
     cttaagtttg aatgtcattt cttcaatggg acggagcggg tgcggttgct ggaaagatgc       240
     atctataacc aagaggagtc cgtgcgcttc gacagcgacg tgggggagta ccgggcggtg       300
     acggagctgg ggcggcctga tgccgagtac tggaacagcc agaaggacct cctggagcag       360
     aggcgggccg cggtggacac ctactgcaga cacaactacg gggttggtga gagcttcaca       420
     gtgcagcggc gagttgagcc taaggtgact gtgtatcctt caaagaccca gcccctgcag       480
     caccacaacc tcctggtctg ctctgtgagt ggtttctatc caggcagcat tgaagtcagg       540
     tggttccgga acggccagga agagaaggct ggggtggtgt ccacaggcct gatccagaat       600
     ggagattgga ccttccagac cctggtgatg ctggaaacag ttcctcggag tggagaggtt       660
     tacacctgcc aagtggagca cccaagtgtg acgagccctc tcacagtgga atggagagca       720
     cggtctgaat ctgcacagag caagatgctg agtggagtcg ggggcttcgt gctgggcctg       780
     ctcttccttg gggccgggct gttcatctac ttcaggaatc agaaaggaca ctctggactt       840
     cagccaacag gattcctgag ctgaaatgca gatgaccaca ttcaaggaag aaccttctgt       900
     cccagctttg cagaatgaaa agctttcctg cttggcagtt attcttccac aagagagggc       960
     tttctcagga cctggttgct actggttcgg caactgcag                              999
//


spacer
spacer