spacer

EBI Dbfetch

ID   AK220540; SV 1; linear; mRNA; STD; MUS; 4063 BP.
XX
AC   AK220540;
XX
DT   01-MAR-2005 (Rel. 83, Created)
DT   01-APR-2006 (Rel. 87, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA4197 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (22-FEB-2005) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7 Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RP   1-4063
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Nagase T., Ohara O.,
RA   Koga H.;
RT   "Prediction of the Coding Sequences of Mouse Homologues of KIAA Gene. The
RT   Complete Nucleotide Sequences of Mouse KIAA-homologous cDNAs Identified by
RT   Screening of Terminal sequences of cDNA Clones Randomly Sampled from
RT   Size-Fractionated Libraries..";
RL   Unpublished.
XX
DR   MD5; ac61b9433dbac02ce927d4b31df064e8.
DR   Ensembl-Gn; ENSMUSG00000075316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164384; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4063
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mfj18089"
FT                   /tissue_type="fetal brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..737
FT                   /codon_start=3
FT                   /gene="mKIAA4197"
FT                   /product="mKIAA4197 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q62205"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001696"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR010526"
FT                   /db_xref="InterPro:IPR024583"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028803"
FT                   /db_xref="MGI:MGI:107636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62205"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD90315.1"
FT                   /translation="YIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWE
FT                   KFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFT
FT                   KRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATIIQRAYRRYRL
FT                   RQNVKNISSIYIKDGDRDDDLPNKEDIVFDNVNENSSPEKTDATASTISPPSYDSVTKP
FT                   DQEKYETDKTEKEDKEKDESRK"
XX
SQ   Sequence 4063 BP; 1339 A; 727 C; 740 G; 1257 T; 0 other;
     gctacatcat catatccttc ctggttgtgg tgaacatgta cattgctgtc atcctggaga        60
     acttcagcgt tgccacagaa gaaagtactg agcccctgag tgaggacgac tttgagatgt       120
     tctacgaggt ctgggagaag tttgaccctg acgccaccca gttcatagag ttctgcaagc       180
     tctctgactt tgcagcagcc ctggatccgc ccctcctcat cgcaaagcca aacaaagtgc       240
     agctcattgc catggacctg cccatggtga gtggagaccg catccactgc ctggacatct       300
     tatttgcttt tacaaagcgg gtcctgggcg agagcggaga gatggattcc cttcgttcac       360
     agatggaaga aaggtttatg tcagccaatc cttctaaagt gtcctatgag cccatcacaa       420
     ccacactgaa gcgaaaacaa gaggatgtat ctgcgactat cattcagcgt gcttacagac       480
     ggtaccgcct taggcaaaac gtcaagaata tatcaagtat atatataaaa gatggagaca       540
     gagatgacga tttgcccaat aaagaagata tagtttttga taatgttaac gagaactcaa       600
     gtccagaaaa gacagatgca acagcctcta ccatctctcc accttcctat gacagtgtca       660
     caaagccaga tcaagagaaa tatgaaacag acaaaacgga gaaggaagac aaagagaaag       720
     acgaaagcag gaaatagagc ttcggttttg atacactgtt tacagcctgc gaaggtgact       780
     cactcgtgtt aataagactc ttttacggag gtctatgcca aactcttttt atcaaatatt       840
     ctcaaaggca gcacagccac tagctctgat ccagtgaaac aagagagaag catttacaca       900
     tggctacttt ttgcgttggt caatgattct ttaagaattg tgcgtgtaac tctacaggga       960
     ataatcatta ttgcaatcaa gggtgactta atgattttaa atatcagaaa accacataga      1020
     acattttctc ttttgcctcc atttctttcc ctagattcta agtagatgtg tacccatgtg      1080
     aatatagaaa ttcaggcgca catgctcaca gtcacaaaca caaacaggat tagctgtgat      1140
     ttggaattcg atgtaaatat ttcacctgtg atttgcaatg aaattccttg taaaagaaat      1200
     gcgaattagt gatgaaggtt ttgtgaaaac atcttatcat tagggagtca gaatctctgt      1260
     ccataaagaa ttcagtttat attttgaggt gctgaaactt atcctacatt gcatcaaaat      1320
     caacttatag gtatctgtaa aatttcatgg gactgaaaaa catatatagg ctacttgttt      1380
     aagaaatggc tttcattgat atagataggc attcaccttg atttatggac atctttggca      1440
     ttctgtgatc acatgattct tccacaaaat tgcttagctg gaacttcagg cacacatcac      1500
     agagaacagc tactcagtct tatgcccctc tctgtttgta caataatcac agagcttgaa      1560
     acattatttg aactataaat atcaggtttc tccacatata tgaatattgt taacagaaaa      1620
     aaattttatt tacagcgttt tatttactaa tatttatcca atctagtttg cccaatgaga      1680
     cagttcatga ctcacatctg aaagccagtt gccacattta tcttcttatg taactttggt      1740
     ttgtcatact ttatgtctaa gcaaattgaa tgtctccttt ctaatgagat gtaccctgaa      1800
     atgcagttag gtacttgata ctttagcgct tgtttgagca gatgactgta gcacagtgtg      1860
     gactgcatct cttaaataca atccttaatg tgtttggcag cttctcaggt tacaaggaac      1920
     acccggcttt tagtgtctat ctgttcacca ggtgtttagt atgaatgaaa cggcattcaa      1980
     agagtgagtc tcactggctt gctttattac tgatgccttc cctatggaga attaatcctc      2040
     tgaagcccca ttatgtcccc ctgtaaataa tgtagatgtc acttccttct taatattcta      2100
     atccatgctg tgaaatcgat tttgcattta tcggtcaaat agagcatttt gagatagttg      2160
     gagttaccct gccaaggatt agaaatctac ttcatgtttt taaagtactt gttaaaaatg      2220
     aacgaccctg gcacattctc tcataatttt attccagcca tgtgaaatct ttcttctaaa      2280
     cactttatcc ttgcggagga aaaaaaaatg agctgatgag ccatttaagc acaaaggggc      2340
     tttatttaga agattccaag ggggaacttt gaagtaaata tataaaacat acttcatcaa      2400
     tttgcctatg aaactaaaag aggaacacag gaatattgat aaaataagtc attaaaacac      2460
     attctttatt tcttgcccag tttaaaagaa agaactaaac atccctagag agaggaagag      2520
     acatagagag agagtgacta atagaaagag ggagagaaga aacaaggcac caaggacaaa      2580
     aagagataat tagacagaac ttgtccaggt tttcacacta tgtgctctgt ccagtaccgt      2640
     acacaagaac ctctttccaa atatttgtcc taaggctcta agaagttaag gctgaaggtt      2700
     gaatacaact gtctttaatc attaacagtt tggggagcta cttttaaacg tctatggaag      2760
     atgccaagca gtggtaagcc agacaataca gagcactgca tatctgtcaa gcagctgaaa      2820
     tatgtttggg caacttaatg gtgagccaca caaaacatcc atttgtaaca attttaatac      2880
     attcaattaa gaaaccagga tttttattat tttgtaccca taaaaatata actatattgt      2940
     tcatttttat tgatagagta tgtgtgaatc ttatggatta tctgtatttt actattaatg      3000
     tttttacagt gactgttttt tttttgtgtg tgtaaactta atatatgtca gcaactggtt      3060
     cctcaacaca atttttttta gcattacaaa aaaatgaaca ggtataaagt ttctcttttt      3120
     tctacatcat gttgaacata ttttgttctg aattacatag ttttaaatgt aatattaagt      3180
     tttatattca tatatgttta acatcaaaat cactacttat gacattgtta tcaatttaaa      3240
     aaatagtatt tgacactagg atagcattta attaaagcta aaaagcttac accccatttc      3300
     atgttgatta gtgtttggac taactctaaa atgtcatcaa tggaagctag tcactgaaat      3360
     tattttatct attgtcatag aatggtgact acccaaaaaa tataagttag cattaaatag      3420
     aagaaagcgt acgtgaccac aaatccatgc acagggttgt gtgaagacag gagaacctca      3480
     tttttctgtt ttgtctcttt ccactgtgta aaaagtctac atctgtgggc tatttctaaa      3540
     ttcaaattgt cacaatttgc aaacataaat gtttagcata ctttgtagaa ttttgatagt      3600
     tttgtaaaag agtgaaaaac aaatgcatat gtaaataaag cagcccatac tagcagattc      3660
     ctcaaatgtt aatatgtaaa taaagcagcc cttactagca gattcatcaa atgttaatat      3720
     gtaaataaag cagtccttat tagcagattt gtcatatgtt aaggggagta atgataagga      3780
     ggcaactaaa tcaggatggt cagtaactga tctgggttta gaactgtgtt tggagccatc      3840
     aatttttaaa tatatgttct cactatgtta ttagttgtct gaagaagcaa tcaagaattg      3900
     ctcccagaaa atgagtaagt agccatgaat atatgaatgc tgtttacaga acccatagac      3960
     ctatgaatgc tcaaaatgtt tgggtttgtc aaaaaattac attgtagtta tacttgatac      4020
     ttaaaaactg ttaatagagt ctaaaataaa agtcgctaaa att                        4063
//


spacer
spacer