spacer

EBI Dbfetch

ID   AK220536; SV 1; linear; mRNA; STD; MUS; 4089 BP.
XX
AC   AK220536;
XX
DT   01-MAR-2005 (Rel. 83, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for mKIAA4192 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (22-FEB-2005) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7 Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RP   1-4089
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Nagase T., Ohara O.,
RA   Koga H.;
RT   "Prediction of the Coding Sequences of Mouse Homologues of KIAA Gene. The
RT   Complete Nucleotide Sequences of Mouse KIAA-homologous cDNAs Identified by
RT   Screening of Terminal sequences of cDNA Clones Randomly Sampled from
RT   Size-Fractionated Libraries..";
RL   Unpublished.
XX
DR   MD5; a313d4f5e7f84a75b4299864c61f42dc.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4089
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="mbh00584"
FT                   /tissue_type="brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..3202
FT                   /codon_start=2
FT                   /gene="mKIAA4192"
FT                   /product="mKIAA4192 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD90530.1"
FT                   /translation="SLEPGVVSALHSGGAERETGTCGRLQDKMFHLRTCAAKLRPLTAS
FT                   QTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHKSW
FT                   DIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIR
FT                   AYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLDLAVFKERLRMLTVGGFYGLHE
FT                   SDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKF
FT                   ETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMS
FT                   SANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHR
FT                   RINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFA
FT                   GQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFH
FT                   VNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQ
FT                   KPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKILHIKHWLDSPWPGF
FT                   FTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGLSRILKTRRELVTNRTV
FT                   DWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQ
FT                   APYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKW
FT                   VRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWI
FT                   VVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPE
FT                   NGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQ
FT                   KYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTE
FT                   LQRFLDTAFDLDAFKKFS"
XX
SQ   Sequence 4089 BP; 972 A; 1098 C; 1057 G; 962 T; 0 other;
     gagtttggag cccggagtgg tgtcggcgct tcactcgggt ggagctgaac gggagacagg        60
     tacttgtgga aggcttcagg acaaaatgtt tcatttaagg acttgtgctg ctaagttaag       120
     gccattgaca gcctcccaga ctgttaagac attttcacaa aacaaaccag cagcaattag       180
     gacgtttcaa cagattcggt gctattctgc acctgtagct gctgaaccat ttcttagtgg       240
     gactagttcg aactatgtgg aggaaatgta ctgtgcctgg ttggagaatc ccaaaagtgt       300
     acataagtca tgggacattt ttttccgaaa caccaatgct ggagccccac cgggcactgc       360
     ctaccagagc cccctttccc tgagtcgaag ctccctggct accatggccc atgcacagtc       420
     cctggtggaa gcacaaccta acgtcgacaa actcgtggag gaccacttgg cggtgcagtc       480
     tctcatcagg gcatatcaga tacgagggca ccatgtagca cagctggacc ccctggggat       540
     tttggatgct gatctggact cctccgtgcc cgctgacatt atctcatcca cagacaaact       600
     tgatcttgca gttttcaagg aacgacttcg aatgctaaca gtaggagggt tctatggcct       660
     acacgagtct gaccttgaca aggtcttcca cttacccacc accactttca tcgggggaca       720
     ggagccagca cttcctcttc gggagatcat ccgtcggctg gagatggcct actgccagca       780
     cattggtgtg gagttcatgt tcattaatga tttggaacaa tgccagtgga tccgacagaa       840
     gtttgagacc cctggaatca tgcagttcac caatgaggag aagcggacct tgctggccag       900
     gcttgtacga tccaccaggt ttgaggagtt cctacagcga aagtggtcct cggagaagcg       960
     ttttggtctg gaaggctgtg aggtgctgat ccctgccctc aagacaatca ttgatatgtc      1020
     aagtgcaaat ggagtggact atgtgatcat ggggatgcca cacagaggac ggctgaacgt      1080
     gcttgcaaat gtcatcagga aggagctgga gcaaatattc tgtcagtttg actcaaagct      1140
     ggaggcagct gatgagggtt ctggggacat gaagtaccac ctgggcatgt atcaccgcag      1200
     gatcaaccgt gtgaccgaca gaaacatcac tttgtccttg gtggctaacc cttcccatct      1260
     agaggctgct gaccctgtcg tgatgggaaa gaccaaagct gaacagttct actgtggaga      1320
     cactgaaggg aaaaaggtga tgtctatcct gctgcatggg gatgctgctt ttgctggcca      1380
     gggcatcgta tatgagacct tccatctcag cgacttgccg tcctacacaa cccatggcac      1440
     tgttcatgtg gttgtcaaca accagattgg cttcaccaca gaccctcgga tggcccgctc      1500
     ctctccctac cccactgatg tggcccgagt ggtgaatgcc cccattttcc atgtcaactc      1560
     agatgaccct gaagctgtca tgtatgtatg caaggtggca gctgagtgga gaaacacctt      1620
     ccacaaggat gttgtagttg atctggtgtg ttatcgacga aatggccaca atgagatgga      1680
     cgaacctatg tttacacagc cactcatgta caagcagatc cgcaagcaga agcctgtact      1740
     gcagaagtat gcagaattgc tagtctccca gggtgtcgtc aatcagcctg agtacgagga      1800
     ggaaatctcc aagtatgata agatctgtga ggaagcattt accagatcca aagatgagaa      1860
     gatcttgcac atcaagcact ggctggattc cccctggcct ggctttttca ccctggatgg      1920
     acagcccagg agcatgacct gcccctccac tggcctggag gaggatgtct tgttccacat      1980
     tggaaaggtg gccagctctg tacctgtgga gaactttact atccatggag ggctgagccg      2040
     gatcttgaag acccgcagag agcttgtgac gaaccggact gtggactggg ccctggcaga      2100
     gtacatggca tttggctcac tgctgaagga aggcatccat gtgcggctga gtggccagga      2160
     tgtggagcgg ggcaccttca gccatcgcca ccatgtgctc catgatcaga atgttgacaa      2220
     aagaacctgc atccccatga accacctttg gccaaatcag gccccttaca ctgtatgcaa      2280
     cagctcgctg tctgaatacg gtgtcctggg ctttgagctg ggctttgcca tggctagccc      2340
     taatgctctg gttctctggg aggcccagtt tggtgacttc aacaacatgg cacagtgcat      2400
     cattgaccag ttcatctgcc caggacaggc aaagtgggtg cggcagaatg gcattgtgct      2460
     cctgctgcct catggcatgg aaggcatggg tcccgagcat tcctctgccc gcccagagcg      2520
     gtttctgcag atgtgcaatg atgacccaga tgtcctgcct gacctgcagg aagaaaactt      2580
     tgacatcaat cagctctatg actgcaactg gattgttgtc aactgttcca cccctggcaa      2640
     cttcttccat gtgctgcgac gacagatctt gctgcccttc cggaagccgt taatcgtctt      2700
     cactcccaaa tccctcctgc gccaccctga ggcaagaact agctttgacg agatgctgcc      2760
     aggaacgcac ttccagcgtg tgatcccaga aaatggacct gcagctcagg acccacacaa      2820
     agtcaagaga cttctcttct gcactgggaa ggtgtactat gacctcaccc gagagcgcaa      2880
     agccaggaac atggaggagg aggtggctat tacaaggatt gagcagctat caccattccc      2940
     ctttgacctc ctgctgaaag aggcacagaa gtatcccaat gctgagctgg cctggtgcca      3000
     ggaagagcac aagaaccaag gctactatga ctatgtcaag ccaagacttc gtaccaccat      3060
     tgaccgtgct aagcctgtct ggtatgctgg ccgagacccg gcagctgctc cagccactgg      3120
     caacaagaaa acacacctga cagagctgca gcgctttctg gacacagcct ttgacctgga      3180
     cgcattcaag aaattctctt agatgctcct ggagttgatg aggccatggc ccccatgtcc      3240
     atgacgctct ttgcttctca actaaagaat agtgcctcag cactgtccac acgtcccttc      3300
     gctgtgccac accacccctg ttctcatagg aattaagttg tccactgcag tgctcagctg      3360
     ctccccggtc acatgctgcc cagcctgtgc cgacttctct caggctgcac accgttcatg      3420
     gagaccggaa ggagcagaat aaggaaaggg cccctctcag gacatcctag agaaggaagg      3480
     cagctctggc cccacccatg cccccagtgc aatcctccag ggtaggaaca gaaccctatg      3540
     tggcttccca gggtactagc actcagccct cgtcacccat caagtcgcag attcaaggcc      3600
     aggagtagtt tcatcttgct agggccaagc tgagagctca tggaggaact atagctgcca      3660
     ggatttggga gtcatcagga tgttgtgtga atagagattg tcatggggta tttagaggac      3720
     tttagcagtg atgttagtct agccctgcta cccttcttgg gtttgggctg tatgtgggaa      3780
     acttacccca gctaccacgc ctggagagct tggctctgag tacggcccag aagctccatt      3840
     ggctcccaac gccaggcact gctgcctctt ggtcctgctg cctctgctct cctgacccct      3900
     ccccagtcac ttcattttct ctgttgttcc cttgaacaca cagaagctgt tgacgaattc      3960
     ttttttttgc tgtgccaagg caggtcaaaa gcagatcagt ggataagagc aagttgtccc      4020
     aaggagccag ctgtccttcc tccctctttt gacctccact gggacacacc tgatttattt      4080
     attttggtt                                                              4089
//


spacer
spacer