Dbfetch

ID   AK173314; SV 1; linear; mRNA; STD; MUS; 5551 BP.
XX
AC   AK173314;
XX
DT   27-JUL-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA1973 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5551
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (19-MAY-2004) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba, 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/11.3.205.
RX   PUBMED; 15368895.
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H.,
RA   Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: IV.
RT   The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 11(3):205-218(2004).
XX
DR   MD5; 2fbfd5b0d63a8859d15820a35ef3d9e1.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5551
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mfj04206"
FT                   /tissue_type="fetal brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..3097
FT                   /codon_start=2
FT                   /gene="mKIAA1973"
FT                   /product="mKIAA1973 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q69Z52"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1933206"
FT                   /db_xref="UniProtKB/TrEMBL:Q69Z52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD32592.1"
FT                   /translation="RGPPGSRKLGEGAGTETLWPRDALLFAVENLNRVEGLLPYNLSLE
FT                   VVMAIEAGLGDLPLMPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQGEMME
FT                   LDLVSSVLHIPVLSIVRHEFPRESQNPLHLQLSLENSLSSDADVTVSILTMNNWYNFSL
FT                   LLCQEDWNITDFLLLTENNSKFHLESIINITANLSSTKDLLSFLQVQLENIRNSTPTMV
FT                   MFGCDMGSIRQIFEMSTQFGLSPPDLHWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVF
FT                   EYYVQDAMELVARAVATATMIQPELALLPSTMNCMDVKTTNLTSGQYLSRFLANTTFRG
FT                   LSGSIKVKGSTIVSSENNFFIWNLQYDPMGKPMWTRLGSWQGGRIVMDSGIWPEQAQRH
FT                   KTHFHHPNKLHLRVVTLIEHPFVFTREVDDEGLCPAGQLCLDPMTNDSSILDSLFSSLH
FT                   SSNDTVPIKFKKCCYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLL
FT                   SGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLG
FT                   IFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKC
FT                   WTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVR
FT                   ESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDA
FT                   DCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLHDKWYKVVPCGKR
FT                   SFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHT
FT                   SQRFHRALNTSFVEEKQPCSKTKRVEKSRWRRWTCKTEGDSELSLFPRSNMGPQQLMVW
FT                   NTSNLSHDNQRKYIFNDEEGQNQLGTQTHQDIPLPPRRRELPASLTTNGKADSLNVARN
FT                   SVMQELSELEKQIQVIRQELQLAVSRKTELEEYQRTNRTCES"
XX
SQ   Sequence 5551 BP; 1511 A; 1370 C; 1266 G; 1404 T; 0 other;
     ccggggtcca cccggctccc gcaagctcgg ggagggcgcc gggaccgaga ccctgtggcc        60
     gcgggatgcc ctactgttcg ctgtggaaaa cctgaaccgt gtggaagggc tccttcccta       120
     caacctgtct ttggaagtag tgatggccat cgaggcgggc ctgggcgacc tgccacttat       180
     gcctttctct tccccaagct caccgtggag cagtgaccct ttctcctttc tgcagagcgt       240
     gtgccacacc gtagtggtac aaggggtttc agcgctgctg gccttccccc agagccaggg       300
     cgaaatgatg gagctggact tggtcagttc tgtcctgcac atcccagtgc tcagcatagt       360
     gcgccacgag tttccgcggg agagtcagaa tcccctgcac ctacagctga gtttagaaaa       420
     ttcactaagt tctgatgctg atgtcactgt ctcaatcctg accatgaaca actggtacaa       480
     ttttagcttg ttgctatgcc aggaagactg gaatatcacc gacttcctac tccttacaga       540
     gaataactcc aagttccacc tcgagtctat catcaacatc actgctaacc tgtcctccac       600
     aaaggacctt ctaagtttcc tgcaggtcca gctggaaaac attaggaaca gcacacccac       660
     aatggtgatg tttggctgtg acatggggag catccggcag atatttgaaa tgtccacaca       720
     gtttgggcta tcacctcctg atcttcactg ggttttagga gactcacaga atgtggagga       780
     gctgaggaca gaaggcctgc ccttagggct cattgctcat ggaaaaacca cacagtctgt       840
     ctttgagtac tatgttcagg atgccatgga gttggttgca agagctgtag ccacagccac       900
     catgatccag ccagaacttg ctctccttcc cagcacaatg aactgcatgg atgtgaaaac       960
     cacaaatctc acttctggac aatatttatc aaggttttta gccaacacca ctttcagagg      1020
     tctcagtggt tccatcaaag taaagggatc caccatcgtc agctcagaaa acaacttttt      1080
     catctggaac ttgcagtatg accctatggg aaagccaatg tggactcgcc tgggtagctg      1140
     gcaaggggga aggattgtca tggactcggg aatatggcca gagcaggccc agaggcacaa      1200
     aacccacttc catcacccaa acaagttaca cttgagagtg gtgacactga ttgaacatcc      1260
     atttgttttc acgagagaag tagatgatga aggcttatgc cctgctggac aactctgtct      1320
     agaccctatg actaatgact cttccatact ggatagcctg tttagcagcc tacatagcag      1380
     taatgataca gtgccaatca agttcaagaa gtgctgctat gggtattgca ttgatctact      1440
     ggaacagtta gcagaagaca tgaactttga ctttgacctc tatattgtag gggatggaaa      1500
     gtatggagct tggaaaaatg gtcactggac tgggctggtt ggtgatctcc tgagtggaac      1560
     agccaacatg gcagtcactt ctttcagcat caatactgca agaagccaag tgatagattt      1620
     caccagccct ttcttctcaa ccagtttggg catcttagtg aggactcgag acacagcagc      1680
     tcccattgga gccttcatgt ggccactcca ctggaccatg tggctgggga ttttcgtggc      1740
     tctacatatc actgccatct tcctcactct gtatgaatgg aagagcccct ttggtatgac      1800
     tcctaaaggg aggaacagaa acaaagtctt ctccttctcc tcagccttga atgtctgcta      1860
     tgcccttctg tttggcagaa cagcagccat caaaccccct aaatgctgga ctggaagatt      1920
     tctgatgaat ctttgggcca ttttctgtat gttttgcctt tctacataca cagcgaactt      1980
     ggctgctgtc atggtaggtg agaagatcta tgaagaactt tctggaatcc atgaccctaa      2040
     gcttcatcat ccttctcaag gttttcgttt tggaactgtc cgggaaagca gtgctgagga      2100
     ctatgtacgg cagagcttcc cagagatgca tgagtacatg agaaggtaca atgtaccagc      2160
     cacccctgat ggagtgcagt acctgaagaa tgatccagag aaactagatg ccttcatcat      2220
     ggacaaagcc cttctggatt atgaagtgtc aatagatgct gactgcaagc ttctgaccgt      2280
     aggaaagcca tttgccattg aaggctatgg cattggtctc cctcccaact ctccgttgac      2340
     ctctaacata tctgagctca tcagtcagta caagtctcat gggtttatgg atgtgcttca      2400
     tgacaagtgg tacaaggtgg ttccctgcgg aaagagaagc tttgctgtca ctgagacttt      2460
     gcaaatgggc atcaagcatt tctctggact cttcgtgctg ctgtgcatag gattcggtct      2520
     ctccatcctg acaaccattg gtgaacacat agtgtacaga ctgctgctac cacgaatcaa      2580
     aaacaaatcc aagctgcagt actggctgca caccagtcag aggtttcaca gagcattaaa      2640
     cacatcattt gtagaagaaa agcagccatg ttccaagaca aaacgtgtgg aaaagagcag      2700
     atggagaaga tggacctgca agacagaagg ggactctgaa ttgtctctgt ttcctaggtc      2760
     caacatggga ccccagcagc tcatggtatg gaatacttcc aatctgagtc acgacaacca      2820
     acgaaaatac atctttaatg atgaggaagg acaaaaccag ctgggtaccc agacccatca      2880
     ggacatccct ctccctccaa ggagaagaga gctccctgct tcactgacca ccaatgggaa      2940
     agcagactcc ctcaatgtag ctcggaactc cgtgatgcag gaactctccg agttggagaa      3000
     gcagatccaa gtgatccgcc aggagctgca gttggccgta agcaggaaga cagagcttga      3060
     ggagtatcaa aggacgaacc ggacttgtga atcctaggct gtgtctctgc tctcctttct      3120
     cagccactgg tactctgagg cccttgaggc tctttgtaaa gctcttttat atctattgac      3180
     aaaggtgtgg ggtctggcaa atgaagtgtg ctgttctcag cctaagatgc agcagcagct      3240
     cttcccacac acgcccccag gtctccaggg tagaaatctt tccaacagta ggaacctaga      3300
     gttagtcagg agtaaagtct gtctaagggg atcggcaagc tgccagacaa ctctggctcc      3360
     tgtcaacctt ttcacctggt gccacaaaag tatttctgct ttttagccct ttctctgcac      3420
     ctcaacaaga gataaaaaaa aactgttgct catacccgta tcttactggg tttgttttta      3480
     atattattac aaaatagaat gatccagtgt tgcagatttg atacaactcc ccaatctaga      3540
     tttgacctaa cattctgaat gaacagggta ggagccacac aaactgggac agaaaagata      3600
     cattaaaaaa aaataataat gaagggagct cagaattcac acaggcaagg gttgactggc      3660
     caagctggca ccatgtgctt gtgcagctct ggatctctga gcctcccctg actaaccttg      3720
     agtaggaaca tgctgatggg acaccaacaa agcacagggt gcttttaaaa taaagccctg      3780
     ggccagaaag gcaatgtggc taaagaatgt attgcactat acttctaatg gaactaatca      3840
     tctccaccat agtgtgtgcc ttctataaag gagaaagcag caaggccatg tccttagcag      3900
     gaacctttgc tagccaccta gtgaatgcct gtaacagggt ctctgagctg actctgtatt      3960
     aagggaaatt ctgcacacca caggtgaggc tttttttcag atcagtggcc acctctttta      4020
     gtctgaggaa tcccagaagc aaccagagac catcataaat gtcaaatacc ggagtctacc      4080
     ctgcttcacc atctcccacc cttatactgt ctctgatgag ttatgctaag ttctagtctg      4140
     attatcctcc tggttccatt taaggccctc agagatcaat gcaattagcc tagcttcccc      4200
     tttgtttagg catcactttc tagtcatata attgcttggc acgaagaaaa gaaacatgag      4260
     ctctctagac ttcctgtatg ttcccaactg ttggctagat aatcatctga ggctatcatt      4320
     atagtgctga tgtccaagac ttaaccagaa gggatctggg agggcctaga ggtgggctca      4380
     gaattctagt gctaggtaac accctaggac acaccacagc cctaacacac cagttattct      4440
     cagagaagca ctgctctgga agtttggcta cctctaggca tgtgagaagg aaggaaagcc      4500
     tattgccttt tctcctttta cttcagcacc cagctactga ctggtttcca tatccccacc      4560
     ctacaccagg gttccatttg gaagtatacc ttgtttatca gtcagtgttg cttaggttct      4620
     cacttctcca gtcattgtaa tgtctacaag gaatgcacaa tggagtgctc agatcactaa      4680
     aaggagcatc agtggcccaa ttcctcttac tttgggacac actgtccaca ctccaccaag      4740
     agctacacag attcccacat aaagatagtg ccctaagttg taatcagaac acttgagcaa      4800
     ggagttaaat ggaggagtaa acctgggagt gcaagaaagc tcaagaaaca ctcaagggga      4860
     ggcagggggg ctttaaaaac agacttcagc ttcacagatt caacatttca ctgagggaag      4920
     ccctgaaaac aggacaaaga gctctgcagc atcctcatgc cctattacat tctcagccca      4980
     gtgggcctca gctgcctttg gtaggttcca tcccttagcc attcccaccc atctgtaaca      5040
     atgatctggg agctcggctc caagcatccc tggttacctg ttcagcctgc aaggccgatg      5100
     tatagtgtac ctcaattcac acgacagcga cagccatgct cctgccgtac atggacatct      5160
     gttcaacgac tcatatttca actgtacccg agaggctagc tatttaaggg aacacagagg      5220
     taaattcttt tgtaaagaat ccttttgtaa tgcaaaccaa ttatccctga aggtatctgt      5280
     tttgtaagtt tggatttttg tatatctggt ttatcttaag cttctctact gaggcattct      5340
     gagtagtggc catcagagtc tcctgcctgc ccacagagca gagaaccagt gcacgctctt      5400
     aagagaaact acttggccaa actggccaag acgcagcaag cagcagcagg aacaaagcag      5460
     gcttactgct gtcaacactg cttaaaatgc tttcatgtcc taggtaaaga aaaaacataa      5520
     ttgcttgtga agcagtttca tgataaatag t                                     5551
//