Dbfetch

ID   AK173230; SV 1; linear; mRNA; STD; MUS; 2620 BP.
XX
AC   AK173230;
XX
DT   27-JUL-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA1675 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2620
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (19-MAY-2004) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba, 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/11.3.205.
RX   PUBMED; 15368895.
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H.,
RA   Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: IV.
RT   The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 11(3):205-218(2004).
XX
DR   MD5; 1a5b8a16c82977a4c8e62ccd281b1877.
DR   Ensembl-Gn; ENSMUSG00000039410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030902; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070313; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2620
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mia50030"
FT                   /tissue_type="adult pancreatic islet"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2124
FT                   /codon_start=1
FT                   /gene="mKIAA1675"
FT                   /product="mKIAA1675 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:A2A935"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR030413"
FT                   /db_xref="MGI:MGI:1917923"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2A935"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD32508.1"
FT                   /translation="ATAATGSEEKFDGRLEDAYAEKVKNRSPDMSDGSDFEDINTTTGT
FT                   DLDTTTGTGSDLDSDLDSDRDKGKDKGKPVESKPEFGGASVPPGAMNSVAEVPAFYSQH
FT                   SFFPPPEEQLLTASGAAGDSIKAIASIAEKYFGPGFMSMQEKKLGSLPYHSVFPFQFLP
FT                   NFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKPKEAKPALLAPK
FT                   VPLIPSSGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKPGVSEGLPKVCPAQLPQ
FT                   QPSLHYAKPSPFFMDPIYSRVEKRKVADPVGVLKEKYLRPSPLLFHPQMSAIETMTEKL
FT                   ESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLT
FT                   RHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRH
FT                   LKKHEHEGAPVSQHSGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEM
FT                   NQASTRMDKRPEIQDLDSNPPCPGSASAKPEDVEEEEEEELEEEDDDSLAGKSQEDTVS
FT                   PTPEPQGVYEDEEDEEPPSLTMGFDHTRRCVEERGGGLLALEPTPTFGKGLDLRRAAEE
FT                   AFEVKDVLNSTLDSEVLKQTLYRQAKNQAYAMMLSLSEDTPLHAPSQSSLDAWLNITGP
FT                   SSESGAFNPINHL"
XX
SQ   Sequence 2620 BP; 670 A; 780 C; 713 G; 457 T; 0 other;
     gccacagcgg ccaccgggtc agaggagaaa tttgatggcc gcttggaaga cgcatatgcg        60
     gagaaggtca aaaataggag ccctgacatg tcggatggca gtgactttga ggatatcaac       120
     accacgaccg ggacagactt ggacactacc acgggcacgg ggtcagacct ggacagcgac       180
     ctggacagtg acagagacaa aggcaaggac aaggggaagc cagtggagag caaacctgag       240
     tttgggggtg catctgtgcc ccctggggcc atgaacagtg tggccgaggt accggccttc       300
     tactcacagc attccttctt cccgccaccc gaggaacagc tgctgacggc ctcgggagct       360
     gccggcgact ccatcaaggc catcgcgtcc atcgcggaga aatacttcgg tcctggcttc       420
     atgagcatgc aggagaagaa gctgggctca ctaccctacc actccgtgtt ccccttccag       480
     ttcctgccta actttcccca ctccctctac ccctttacgg accgagccct cgcccacaac       540
     ttgctggtca aggctgagcc aaagtcaccc cgggatgccc tcaaggtggg cggccccagt       600
     gcggagtgcc ccttcgacct caccaccaaa ccaaaagagg ccaaacccgc cctgctcgca       660
     cccaaggtcc ccctcatccc ctcatctggc gaggaacagc cactggacct gagcatcggc       720
     agcagggcca gggcaagcca gaacggaggt ggccgtgagc cgcggaagaa ccacgtctac       780
     ggtgaacgga agccgggggt cagcgagggg ctgcctaagg tgtgcccagc acagctgccc       840
     cagcagccct ccttgcatta tgctaagcct tcaccgttct tcatggatcc catctacagc       900
     agggtagaaa agcggaaggt ggcagaccct gtgggagtcc tgaaagagaa gtacctgcgg       960
     ccgtccccac ttctgttcca cccccagatg tcagccatag aaaccatgac ggagaagctg      1020
     gagagctttg cagccatgaa ggccgactca ggcagctccc tgcagcccct gcctcaccac      1080
     cctttcaact tccgctcccc acccccaacg ctctcggatc ccatcctcag gaaggggaag      1140
     gagagataca cgtgcaggta ctgtggcaag atcttcccca gatctgcaaa tctcacaaga      1200
     catctgagga cacacacagg ggagcagcca tacaggtgca agtactgtga ccggtcattc      1260
     agcatctcct ccaacctcca gcggcacgtg aggaacatcc acaacaaaga gaagccgttc      1320
     aagtgccatc tgtgcaaccg ctgcttcggg cagcagacca acctagaccg gcacctgaag      1380
     aagcacgaac acgagggcgc accagtgagc cagcactccg gggtgctcac gaaccacctg      1440
     ggcaccagcg cctcctcccc cacctccgag tcggacaacc atgcactttt agatgagaag      1500
     gaagattctt acttctccga gatccgaaac ttcatcgcca acagcgagat gaaccaggca      1560
     tccactcgaa tggacaaacg gcctgagatc caagacctgg acagcaaccc accgtgtcca      1620
     ggctcagcca gtgcaaagcc agaggacgta gaggaggagg aagaggagga gctggaggaa      1680
     gaggatgatg acagcttagc cgggaagtca caggaggaca cggtgtcccc cacacctgag      1740
     ccccaaggag tctatgaaga tgaagaggat gaggaaccac ccagcctgac catgggcttt      1800
     gaccataccc ggaggtgtgt tgaggagcga ggaggcggcc tgttagcttt ggagccgacg      1860
     ccgacctttg ggaaggggct ggatctccgc agagcagctg aggaagcatt tgaagttaaa      1920
     gatgtgctta attccacctt agattctgag gttttaaaac aaaccctgta caggcaggct      1980
     aagaaccagg catatgcaat gatgctgtcc ctctctgaag acactcctct ccacgccccc      2040
     tcccagagct cactggatgc ttggttgaac atcacaggac cctcgtcaga gtccggagcc      2100
     tttaacccca tcaaccacct ctgaggtcct ggaggcccca gggccagagt ccaaagccag      2160
     ggtaccagct gcaggagatg gagaaggggc cagggagcag ccccccaccc tcaacacctc      2220
     cactttgcaa agtccagctt ctccattgaa actcagaacc cgaaggtccc ttgagtagcc      2280
     gctggccttc atcacctctc agaactggcc tcaaggacac gatctgcagt gggtgcggtg      2340
     cacgggccac ccaggagctg ctcacaggag ccatggatca gaaaactcgt gggcaagggt      2400
     ggggtctcta tcccagcagg agccagttgg ccacatccag gcaactgcat ggtatgaaag      2460
     aggaaatcgg aaagacgtgg gcaagtgcta tggagagaga cctcatcaat gatttttata      2520
     atgagaatca catgattaag ccttttggta atcttattga ctatagagtc tatttaagca      2580
     tgtgggtttt aaaaaaaata gacggtattt tttaaaaatc                            2620
//