spacer

EBI Dbfetch

ID   AK173228; SV 1; linear; mRNA; STD; MUS; 4507 BP.
XX
AC   AK173228;
XX
DT   27-JUL-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for mKIAA1650 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (19-MAY-2004) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RP   1-4507
RX   DOI; 10.1093/dnares/11.3.205.
RX   PUBMED; 15368895.
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H.,
RA   Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: IV.
RT   The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 11(3):205-218(2004).
XX
DR   MD5; f218b28be9642a822c54157506a52e5d.
DR   Ensembl-Gn; ENSMUSG00000022623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109309; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4507
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="mbg18106"
FT                   /tissue_type="brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2572
FT                   /codon_start=2
FT                   /gene="mKIAA1650"
FT                   /product="mKIAA1650 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q4ACU6"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="MGI:MGI:1930016"
FT                   /db_xref="PDB:3O5N"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ACU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD32506.1"
FT                   /translation="PLGPLPYPERQKRARSMIILQDSAPEVGDVPRPAPAATPPERPKR
FT                   RPRPSGPDSPYANLGAFSASLFAPSKPQRRKSPLVKQLQVEDAQERAALAVGSPGPVGG
FT                   SFAREPSPTHRGPRPGSLDYSSGEGLGLTFGGPSPGPVKERRLEERRRSTVFLSVGAIE
FT                   GSPPSADLPSLQPSRSIDERLLGTGATTGRDLLLPSPVSALKPLVGGPSLGPSGSTFIH
FT                   PLTGKPLDPSSPLALALAARERALASQTPSRSPTPVHSPDADRPGPLFVDVQTRDSERG
FT                   PLASPAFSPRSPAWIPVPARREAEKPPREERKSPEDKKSMILSVLDTSLQRPAGLIVVH
FT                   ATSNGQEPSRLGAEEERPGTPELAPAPMQAAAVAEPMPSPRAQPPGSIPADPGPGQGSS
FT                   EEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANGILLTTPPPGPGPLPTT
FT                   VPSPASGKPSSELPPAPESAADSGVEEADTRSSSDPHLETTSTISTVSSMSTLSSESGE
FT                   LTDTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSSDSELMAQQHHAA
FT                   STGLASAAGPARPRYLFQRRSKLWGDPVESRGLPGPEDDKPTVISELSSRLQQLNKDTR
FT                   SLGEEPVGGLGSLLDPAKKSPIAAARLFSSLGELSTISAQRSPGGPGGGASYSVRPSGR
FT                   YPVARRAPSPVKPASLERVEGLGAGVGGAGRPFGLTPPTILKSSSLSIPHEPKEVRFVV
FT                   RSVSARSRSPSPSPLPSPSPGSGPSAGPRRPFQQKPLQLWSKFDVGDWLESIHLGEHRD
FT                   RFEDHEIEGAHLPALTKEDFVELGVTRVGHRMNIERALRQLDGS"
XX
SQ   Sequence 4507 BP; 841 A; 1510 C; 1272 G; 884 T; 0 other;
     gcctctgggc ccgctgccct accctgagcg tcagaagcgt gcgcgctcca tgatcatact        60
     gcaggactct gcgccagaag tgggtgatgt cccccggcct gcgcctgccg ccacaccgcc       120
     tgagcgcccc aagcgccggc ctcggccgtc aggccctgat agtccctatg ccaacctggg       180
     cgccttcagt gccagcctct tcgctccgtc gaaaccacag cgccgcaaga gcccgctggt       240
     gaagcagctt caggtggagg acgctcagga gcgcgcggcc ctggccgtgg gtagcccggg       300
     accagtgggc ggaagctttg cacgagaacc ctctccgacg caccgcgggc cccggccagg       360
     cagccttgac tacagctctg gagaaggcct aggccttacc ttcggcggcc ctagccctgg       420
     cccagtcaag gagcggcgcc tggaggagcg acgccgttcc actgtgttcc tctctgtggg       480
     tgccatcgag ggcagccctc ccagcgcgga tctgccatcc ctacaaccct cccgctccat       540
     tgatgagcgc ctcctgggga caggcgccac cactggccgc gatttgctac tcccctcccc       600
     tgtctctgct ctgaagccat tggtcggtgg tcccagcctt gggccctcag gctccacctt       660
     catccaccct ctcactggca aacccttgga tcctagctca cccttagctc ttgctctggc       720
     tgcccgggag cgggctctgg cctcgcaaac accttcccgg tcccccacac ctgtgcacag       780
     ccccgatgct gaccgccctg gacccctctt tgtggatgtg caaacccgag actctgagag       840
     aggaccgttg gcttccccag ccttctcccc tcggagtcca gcgtggattc cagtgcctgc       900
     tcggagagag gcagagaagc cccctcggga agagcggaag tcaccagagg acaagaagtc       960
     catgatcctc agcgtcttgg acacgtcctt gcaacggcca gctggcctca ttgttgtgca      1020
     tgccaccagc aatgggcagg agcccagcag gctgggggct gaagaggagc gccccggtac      1080
     tccggagctg gccccagccc ccatgcaggc agcagctgtg gcagagccca tgccaagccc      1140
     ccgggcccag ccccctggca gcatcccagc agatcccggg ccaggtcaag gcagctcaga      1200
     ggaggagcca gagctggtat tcgctgtgaa cctgccacct gctcagctgt cctccagcga      1260
     tgaggagacc agagaggagc tggcccgcat agggctagtg ccaccccctg aagagtttgc      1320
     caatgggatc ctgctgacca ccccgccccc agggccgggc cccttgccca ccacggtacc      1380
     cagcccggcc tcagggaagc ccagcagcga gctgccccct gcccctgagt ctgcagctga      1440
     ctctggagta gaggaggctg acactcgaag ctccagtgac ccccacctgg agaccacaag      1500
     caccatttcc acagtgtcca gcatgtccac cctgagctcg gagagtgggg aactcacgga      1560
     cacccacacc tcctttgccg atggacacac ttttctactc gagaagccac cagtgcctcc      1620
     caagcccaag ctcaagtccc cgctggggaa ggggccggtg accttcaggg acccgctgct      1680
     gaagcaatcc tcggacagtg agctcatggc ccagcagcac catgctgcct ctactgggtt      1740
     ggcttctgct gctgggcccg cccgccctcg ctacctcttc cagagaaggt ccaagctgtg      1800
     gggggacccc gtggagagtc gggggctccc tgggcctgaa gatgacaaac caactgtgat      1860
     cagtgagctc agctcccgtc tgcagcagct gaataaagac acacgctcct tgggggagga      1920
     accagttggt ggcctgggca gcctgctgga ccctgctaag aagtcaccca ttgcagcagc      1980
     tcggctcttc agcagcctcg gtgagctgag caccatctca gcgcagcgca gcccgggggg      2040
     cccgggcgga ggggcctcct actcggtgcg gcccagcggc cggtaccccg tggcgagacg      2100
     agccccgagc ccagtgaaac ccgcatcgct ggagcgggtg gaggggctgg gggcgggcgt      2160
     gggaggcgcg gggcggccct tcggcctcac gcctcccacc atcctcaagt cgtccagcct      2220
     ctccatcccg cacgaaccca aggaagtgcg cttcgtggtg cgaagtgtga gtgcgcgcag      2280
     ccgctccccc tcaccatctc cgctgccctc gccttctccc ggctctggcc ccagtgccgg      2340
     cccgcgtcgg ccatttcaac agaagcccct gcagctctgg agcaagttcg atgtgggcga      2400
     ctggctggag agcatccact taggcgagca ccgagaccgc ttcgaggacc atgagatcga      2460
     aggcgcacac ctgcctgcgc tcaccaagga agacttcgtg gagctgggcg tcacacgcgt      2520
     tggccaccgc atgaacatcg agcgtgcgct caggcagctg gatggcagct gacgccccac      2580
     tccctctcct gttcctgctg cgccctgccg gcagggcccc cacccctact ccaggccgca      2640
     ggctcggctc gccccctacc acggcgcccg ggccaggaat gttgcatgaa tcgtcctgtt      2700
     tgctgttgct tggagacttg ccctgtacat tgcttagtgc cctcccctgc cgctgaaccc      2760
     cacccagcac acagtaaggg cgcggaccag gggggctggg tggaaggggg tgggggcagg      2820
     gtgctctggc ctgaccactt cctccatagc tcctggtggc cattcttcca gagggggaac      2880
     ctagtccagc atgcgaggtc aggacacgcc ttggtgactc ggggggaggg gggagacatt      2940
     ggggttctcg ataggggcca aggagccccc tgttttacat attttaatcc actctatatt      3000
     tggaaagaga aaaggaacaa atatctctgt ccgtaatagt tcccgccctc ttcccctcta      3060
     gtcctctcgc tggtcccgcc acagctgccc agtcttccat ctctggcccc tcactgccac      3120
     cccatacagg gcaggggaca ctccagctgg cctggggtta gccagggtcc tggcagccca      3180
     ccctggggac cccggctcag ccccccttcc ctcgctgagc tatagtatgc cccacccacc      3240
     ctttaggtgc tgctcagggg gacgggtggc aggcattgcc tgctgggcac tagcagggcc      3300
     aggtggcctg ggaaattatt gccctggggc tgggccccgg taacccaaac cccagccatc      3360
     atcttcacag ggtctctccc acaggagggg tctaaccttt cccacttctt gggcaactac      3420
     agcagagaag cctccctgcc tcgcacccca aagactcccc aattcctgcc ctgtgtgtgt      3480
     gtgtgcgcca cataatgtgt gtgcacgcct gtgtgcttgt gaaaactggg tgtggctgag      3540
     cgcatgggtg ccctgtgtgt gcttgactgt gcagtggtcc ccaggggctg ttctggatgg      3600
     gtgggaggtg gcggcagaag cttgcacagg gtgcatgcat gggtgtgtgc ccgggaaggg      3660
     gccctgtcct gctggtgggt cctgctgttc tctcagcctg tcccctcctc cccaaacctc      3720
     acccagctta agcagggatt cttcgtgaat cctttcagct tcgggaggcc tcaagggctc      3780
     cccccgcagg cagtacccct tcgggcttct aagggaattg tggggaccac taaaatcagg      3840
     ccacaacagc ccttggagag aggcaaagac tcctgagggt cccctggccc ccttactgtg      3900
     actcctcaca ctcagcaatg acctgtgggg tggggggccc tggggcattt ttaaacatcg      3960
     ggtttggagt ctggactaag ctccatccac gtcactcaca agtttctgtt tctatttcta      4020
     gcttttttta ataaaaaata aataaataaa taaatatata aataaatata tatatatata      4080
     aaagacagaa aacaggtgtt ttcatggccc aggggcttgg cacgccggtc tgtgcccacc      4140
     tgccccaccc tggcccatcg gccccattcc ttagacacag agtcacaccc actaaccctc      4200
     tcaccaacag agcaggtcac acacacagca gcagtcactg taacagactg ccacatacac      4260
     agtctcacat ttacctgtgg gtttttggtt ctgttcaatt tgggttttta actttacagg      4320
     gtcagttccg cttctccccc cccccctttt gtatggagtt ccatctgggg ggctttcaac      4380
     cccctgctcc agtcctgagg cctcctgacc ctgacgttgt gatacacccc acagagatct      4440
     atgtttctta tattattatt attaataata attattataa tattatgtaa taaatttata      4500
     agaaatg                                                                4507
//


spacer
spacer