Dbfetch

ID   AK173121; SV 1; linear; mRNA; STD; MUS; 2553 BP.
XX
AC   AK173121;
XX
DT   27-JUL-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA1174 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2553
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (19-MAY-2004) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba, 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/11.3.205.
RX   PUBMED; 15368895.
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H.,
RA   Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: IV.
RT   The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 11(3):205-218(2004).
XX
DR   MD5; d8f3e874512fb4689d2c0a26aa04bbd3.
DR   Ensembl-Gn; ENSMUSG00000022999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109127; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2553
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mng09212"
FT                   /tissue_type="NKT cells"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <625..2028
FT                   /codon_start=1
FT                   /gene="mKIAA1174"
FT                   /product="mKIAA1174 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q9D1E5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1289247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD32399.1"
FT                   /translation="SWISILLFATLYILCHIFLTRFKKPAEFTTVDDEDATVNKIALEL
FT                   CTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLVF
FT                   LMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTLLVLGMVWVASAIVDNDKASRES
FT                   LYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLNCS
FT                   AFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQRVLLEKRRKASAWQRNLGYPLAM
FT                   LCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAALGQASFSKLGSFGAIIQVVLIFY
FT                   LMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLL
FT                   GDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAFGLDRLPLPVSGFP
FT                   RASRKKQHQ"
XX
SQ   Sequence 2553 BP; 502 A; 682 C; 681 G; 688 T; 0 other;
     ggaaccccaa gcctgacctt ttgagctcta ctaccctctt ggctgttaat caagttcaag        60
     accaaaaggg gcagagaagg agctgttggg aaaattcagc ttccatctta gtggctcttc       120
     ctatggggac ttcctaaatc aaaagctatc actttattct agacacagga ctttcttggt       180
     ctcctctttg tcactgtaca gatttcctct agggtctgtt tatcttggag actagaagac       240
     acgtgagatc gagcttgtct gtgcctacct caaatgcaat gacatttccc ttttgttttt       300
     ctgatgcctt ggaatggtgt agagatgtaa tgcttgtact acttatctgt ccaagttctg       360
     tcctgtcatt tggaggtcta accactcaag gccatgtgta ggtcctaaga tacttggctc       420
     tgaagttaga aattacttat ggtagggtct caggagtgac tacttttaga gtgacagatg       480
     acctgctctg gaaatgttgg gcccgactaa agccttctct caagctgaag gggccctggt       540
     ttggagtaga agttctgatt tgctctccag atgggattct tatgcagtag tgcctggggc       600
     atacgctctc actacagcaa ctgaagctgg atctcaatac ttctgtttgc aacactctac       660
     atcctctgcc atatcttcct gacccgcttc aagaagcctg ctgagttcac cacagtggat       720
     gatgaagatg ccacagttaa caagattgcg ctggagctgt gcacctttac cctggcggtc       780
     gccctgggcg ccgtcttact cctgcccttc tccatcatca gcaacgaggt gctgctctcg       840
     ttgccacgca actactacat ccagtggctc aatggctccc tcatccatgg tctgtggaac       900
     ctcgttttcc tcttctccaa tctgtccctc gtcttcctta tgccctttgc atatttcttc       960
     acagagtctg aaggctttgc tggctccaga aagggtgtcc tgggccgggt ctacgagaca      1020
     gtggtgatgt tgatcctcct cacgctgctt gtgctgggca tggtgtgggt ggcatccgcc      1080
     attgtagaca atgacaaggc cagcagggag tcgctctacg acttctggga gtactacctc      1140
     ccctatctct actcctgtat ctccttcctc ggagttctgc tgcttctggt gtgcactcca      1200
     ctaggtctcg cccgcatgtt ctctgtcact gggaagttgc tggtcaagcc ccggctactg      1260
     gaagacctgg aggaacagct gaactgctca gcctttgagg aggcagctct gactcgaaga      1320
     atctgcaatc ccacctcctg ctggctgcca ctggacatgg aactgctgca tagacaggtc      1380
     ctggctctgc aggcacagag ggtcctcttg gaaaagcgtc ggaaggcgtc agcctggcaa      1440
     cggaacctgg gctaccctct ggccatgctg tgcttgctgg tgctgacggg cctgtctgtc      1500
     ctcatcgtgg ctgtccacat cctggagctg cttattgacg aggctgccat gccacggggc      1560
     atgcaggatg ctgccctagg ccaggcctcc ttctccaaac tgggatcctt tggcgccatc      1620
     atccaggttg tgctgatatt ttacctgatg gtgtcctcag tggtgggttt ctacagctct      1680
     ccactctttg gaagcctgag gcctaggtgg catgacacat cgatgacaca gatcattggg      1740
     aactgtgtct gcctcctggt cctcagctca gcacttcctg tcttctctag aactcttggc      1800
     ctgacacgct ttgacctgct gggtgacttt ggacgcttca actggctagg caatttctac      1860
     atcgtgttcc tctacaacgc agcctttgct ggcctcacca cactctgtct ggtgaagacc      1920
     ttcacggcag ctgtgagggc agagctgatc cgagcctttg ggctggacag actgccactg      1980
     cctgtctctg ggtttccccg ggcttctagg aagaagcagc atcaatgacc tccagctggg      2040
     ggctgagaag gagagaactg ggcagtgcct aggcctggcg gtgagcccca gggggctgca      2100
     cctcaggacc tggaacctga gagtaggtga cagaggggac ggaccatctg cactgttgct      2160
     taatctgagc cagagtttgg gacccggctg gcctcctgcc ttttcagatg tagctgtggc      2220
     ctgagcatcc atctggtgga gctgggggac tcgctctagt tcctggaccc aaatacgttt      2280
     acacatctat ctgcctcaat cctgttccag gccatgcctg aagccatgtt tacatgattt      2340
     gatgtgcaat agggtgggtg ggacttgggg ggactgggcc aggggtaggt tctggagaca      2400
     ggtcttcctt gcctctggcc cagaagagcc gaagtactgt gctatcctgt ggagggcttt      2460
     ggaccactgg agagaccaag ggtgctggga ggaggcggct gcacccacga gcaataaaat      2520
     tgatcccagg gttttcttgg ttcttttgta aag                                   2553
//