spacer

EBI Dbfetch

ID   AK173110; SV 1; linear; mRNA; STD; MUS; 4389 BP.
XX
AC   AK173110;
XX
DT   27-JUL-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA1144 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4389
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (19-MAY-2004) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba, 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/11.3.205.
RX   PUBMED; 15368895.
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H.,
RA   Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: IV.
RT   The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 11(3):205-218(2004).
XX
DR   MD5; 99111ddf4f88efb59349901db7bd960b.
DR   Ensembl-Gn; ENSMUSG00000050963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072868; mus_musculus.
DR   RFAM; RF00485; K_chan_RES.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4389
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mfj54204"
FT                   /tissue_type="fetal brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <437..1975
FT                   /codon_start=1
FT                   /gene="mKIAA1144"
FT                   /product="mKIAA1144 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q69ZQ8"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003971"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1197011"
FT                   /db_xref="UniProtKB/TrEMBL:Q69ZQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD32388.1"
FT                   /translation="CLPAGRGSFPPASAAGSRAPRCSAPARRGRLGISSMTRQSLWDVS
FT                   DTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREF
FT                   YFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKV
FT                   EPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSR
FT                   VFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTFELVARF
FT                   AVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESSPTLANLGRVAQVLRLMRIFRI
FT                   LKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLATIPAC
FT                   WWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQL
FT                   ESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLDDSLH"
XX
SQ   Sequence 4389 BP; 1043 A; 1030 C; 1115 G; 1201 T; 0 other;
     aagctggggg gcgcccgaag aacagaatga tgctccggaa cgtctcaaga gtctgggcgg        60
     cgactgtgcc ccgggctggc gcgctcggag ctgtccgttc agcaccaccg cgcagcacca       120
     ggctcaaggc cctctgcaag gcgcaccggc tcggttcccg cccccgctcc acgggcgcct       180
     gcggcgtggg ctcctgcctc tcgtggtggg tgaggggcgc gcagatcgga agaggggggc       240
     tccacgagcg tcggggccac gcagccacct gtgagcctct cgcggatgtg ggcggtggtg       300
     tgtgcggccg gagactgaag gaggcgcacg gtggaccccg cctgcccggt ggcggggcac       360
     acagacaagc actcacatct acatcctcgc acccgcgcgc actcgcgcag ccagccaacg       420
     gcgtccaccg cggtgatgct tgccagcagg tcggggaagt ttcccgccgg cctctgccgc       480
     gggctcccgt gcacccaggt gtagcgcccc cgcgcggcgc gggcgcctgg gcatctccag       540
     catgacccgc cagagcctgt gggatgtgtc cgataccgac gtcgaggatg gagagatccg       600
     catcaatgtg ggtggcttca agagacggct gcgttcccat acgctgctgc gcttccctga       660
     gacacgcctg ggccgtctgc tcctctgcca ctcgcgagag gccattctgg aactctgcga       720
     tgactacgat gacgttcagc gtgagttcta cttcgaccgt aaccccgagc tcttccccta       780
     tgtgttgcat ttctaccaca ccggcaagct tcacgtcatg gctgagctgt gcgtcttctc       840
     cttcagccag gagatcgagt actggggtat caatgagttc ttcatcgact cttgctgcag       900
     ctatagctat cacggccgca aagtggaacc tgagcaggag aaatgggacg agcagagtga       960
     ccaggaaagc accacttcct ccttcgatga gatcttggcc ttctataatg atgcttccaa      1020
     gttcgatggg caacccctgg gcaacttccg caggcagctg tggctggcgt tggacaaccc      1080
     aggctactca gtcctaagca gggtcttcag tgtcctttcc atcttggtgg tgttgggctc      1140
     catcatcacc atgtgcctca atagcctgcc agacttccaa atccctgata gccagggtaa      1200
     ccccggtgaa gaccccaggt tcgaaattgt ggagcacttt ggcattgctt ggttcacatt      1260
     tgagttggtg gccaggtttg ctgtggcccc tgactttctt aagttcttca agaatgctct      1320
     aaaccttatt gatctcatgt ccattgtccc attttacata actctagtgg tgaacctggt      1380
     ggtggagagt tctcctacct tggctaactt gggcagggtg gctcaagtcc tgaggctaat      1440
     gaggatcttc cgaattctca agctggccag acactccact ggcctccgct ccttgggagc      1500
     caccctgaag tacagctaca aggaagtggg gttgctcttg ctctacctct cagtggggat      1560
     ttccatcttc tctgtggtgg cctacaccat tgaaaaggag gagaacgaag gcctggccac      1620
     catccctgcc tgctggtggt gggccactgt cagtatgacc acagttgggt acggagatgt      1680
     ggtcccaggg acaacagctg ggaagttgac tgcctctgcc tgcatcttgg caggcatcct      1740
     ggtggtggtc ttgcccatca ctttgatctt caataagttc tcccatttct atcggcgcca      1800
     aaagcaactt gagagtgcta tgcgcagctg tgactttgga gatggaatga aagaggtccc      1860
     ttcggtcaat ttaagggact actatgctca taaagttaag tccctcatgg caagtctgac      1920
     aaacatgagt aggagttcac ctagtgaact gagtttagat gattctctac attagctgga      1980
     ccccgactta cattgctgat ctgctgcttg tggttctagc acaatcaggg caattttagg      2040
     gctgtggcat aagaaatcat ccctgcccta gagggagagc tgcatgggac ataagcccta      2100
     gattgctttt gcaatgttta gagaggtttc ttttttcttt tgaggatggt gtgtctaata      2160
     acatgccttt gcacctctca gtgaagtgac actcactggt gtttgcatca tggcaaaaaa      2220
     aaaaatgttc acctttctgc cagatgagta tctagaatgc caatttctct gtccactgtg      2280
     tacagtattc taatgctcat atcccagcat tacctgtgag tggaattgtc tgtgctccta      2340
     tttccgaggc tgctgtatgg gttccagtga caacacatct gtctatgagg tcagcaagga      2400
     tatcgtgaga tttggatcac aaccatgtga aaataatctc aattatgtat cccttgcttt      2460
     catttacctt taataccaaa acagagagat cgcaaagcta agcacacttg accaatgcaa      2520
     atcttcgagt tgtctttcta cttggtcctg tccttgtgat gtgcatgaat gcaccagtca      2580
     ttttaaagaa agatatgtat tgatgtatat ctcctaagtg tcagtgtaaa gagaatgtta      2640
     cttagtcgat atgtagtaaa gactgaatgt ttttcctcca aacagttaaa tttagggaca      2700
     gcgactttag ctaaacatgg accaaacccc aggagttcat gtaggctaag cccttttact      2760
     gatggtcagg cctcttttca tttatttctg gctgagatgc tcaatccagg ccattttgac      2820
     caaagtttgc tgtgtcttgg tattagcatg tttttcaagc atctcttttt taagatgttt      2880
     aggaataagg ccgtgctgtc tttctcctcc actggaagaa gtttgtgttt tgttgtcttt      2940
     gtgaggtaag cactgtcagg ttgctggcaa gggcaatagc ttaaatattt tcttgcctgc      3000
     tctaaaagcc cataaaatga atgttctttt gtttctgagc agagtttcct ttaggtagtt      3060
     ttgcttctag gacacaggat agtgtatgta tagtgtttga ttgccttgag ttcctgcctt      3120
     ggcatggaaa cctggtagtg cagagcatat tcaagatgca gacatgcatg aaggcaggtg      3180
     gcttacccag ggtggaaaca ctgtagcttt tatttccatt gcaattgcaa tggggtttgg      3240
     gggacagggg tagaagtcaa aagaaaagag ttataaagcc aaaaactact ttataagata      3300
     taaataactg tgagcttctt taaaagctta aaactagtaa aatagaaaac aaaaacaaca      3360
     aacaaccctt tcaaccatta agctgtgttg aagggttacc tctatttcct tttccaacac      3420
     actgttcagt taacacaaaa cattatgaag gggcacctgg gcccccttta agaaaattct      3480
     ttcccatcat tgtctaagta atctgatggt tttccagtgg ctttcattat tgttgagtct      3540
     ttggcaaggc tatagaatcc agggatccaa atacggagat aaacaggctt ttaatccaaa      3600
     gtttgggcct actcttaatt ggtccatttt gtgttttagt cagttaagga caatccacac      3660
     ttcacagggg tgtggaatgg atcttctcag agggctctgt gtactagtgg ttgccatggt      3720
     gactacagtg tgggcgattt gttggatgaa tgcactgacc atttaatgcc cttgagcctc      3780
     cagttcagat ctttcatcag actggagact gatgaggggc agaaggtggc aacctcctag      3840
     tgcctacgtg cagacacatc tatgtctatt attccaaagc agcaggaatg tgaggttgac      3900
     ttcaaggaac cccgcctgtg aatcagaaga caggagttgg ttttgggagt ttgcatatgg      3960
     aactcttgtt gttggctggt atcttcagca ctagaagacc aaggatgtat aaaactgttc      4020
     ccagttgcac tgaaggcagg ggacagccta acctgtgagg actgtttggt ttgctgaggc      4080
     tgatggtata ccataactgg gcatgaattg catggtcact gaccatgaag ctgatggaaa      4140
     gaagaaaaga ggagatgcag agtaacttag ccactctcct aaggattttt ctaaatgaac      4200
     atgtttaaca ccaaaaagga gatacctgca aggatatgaa agctggaaaa cttgactttt      4260
     cttttttggt gatgacttgt tttatctggt gcctttcatt gggggaatcc caaagtgctt      4320
     tagagactgt ctttttaaca tttcttgtag atatatgtat aattgtaaaa gaatattcct      4380
     ttgcccacc                                                              4389
//


spacer
spacer