spacer

EBI Dbfetch

ID   AK172921; SV 1; linear; mRNA; STD; MUS; 4469 BP.
XX
AC   AK172921;
XX
DT   27-JUL-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA0263 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4469
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (19-MAY-2004) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba, 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/11.3.205.
RX   PUBMED; 15368895.
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H.,
RA   Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: IV.
RT   The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 11(3):205-218(2004).
XX
DR   Ensembl-Gn; ENSMUSG00000032594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035214; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4469
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mfj32020"
FT                   /tissue_type="fetal brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <297..1661
FT                   /codon_start=1
FT                   /gene="mKIAA0263"
FT                   /product="mKIAA0263 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q6A097"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="MGI:MGI:1351633"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A097"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD32199.1"
FT                   /translation="LSFCGPCAASSAISVQPAPNAMCVCQTMEVGQYGKNASRAGDRGV
FT                   LLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFTPEYKGVVSVCFEG
FT                   DSDGYINLVAYPYVESETVEQDDTPEREQPRRKHSRRSLHRSGSGSDHKEEKASLSFET
FT                   SESSQEAKSPKVELHSHSDVPFQMLDSNSGLSSEKISYNPWSLRCHKQQLSRMRSESKD
FT                   RKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRV
FT                   CGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLK
FT                   AVLERQASYRFYSSSLLVIYDGKECRSELRLKHVDMGLPEVPPPCGPSTSPSSTSLEAG
FT                   PSSPPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ"
XX
SQ   Sequence 4469 BP; 915 A; 1208 C; 1257 G; 1089 T; 0 other;
     gctgtccttg gttactatga cgcccggccc ccgccccctc ggctggccgc catcttgttg        60
     ttgatccgta cccagtgggc agcgccagga gctggaccga gcggccggtg aggggccgct       120
     gctgcggggc tcagccacca gcgccgcctg ccaggggggc gggccgagac ctggaggccc       180
     ggggggccca gctcccgtgg ggagccttgg gcgcccgctg cccgagtcgg gccggacaga       240
     acagtaaact aagcagactg tgaccattgg cctcccacta gccaggatca acttagctct       300
     ccttttgtgg tccatgtgct gcatcgtctg ccatcagtgt gcaaccggcc cccaacgcaa       360
     tgtgtgtttg tcaaaccatg gaagtggggc agtatggcaa gaacgcaagt cgggccggag       420
     accgaggagt cctcctggag cccttcatcc atcaggtggg cgggcacagc agcatgatgc       480
     ggtacgacga ccacactgtg tgcaaacctc tcatctcccg ggaacagcgc ttctacgagt       540
     cactccctcc cgaaatgaag gaattcaccc cagagtacaa aggcgtggtt tctgtctgtt       600
     ttgagggaga cagtgatggt tacatcaact tggtagccta tccttatgtg gagagtgaaa       660
     ctgtagagca agatgacaca ccagagcggg agcaacctcg gcgcaaacac tcccgccgga       720
     gcctgcatcg gtctggcagt ggtagtgacc acaaggagga gaaagccagc ctgtcctttg       780
     agacctctga gagctcccag gaggcaaaga gtccaaaggt ggaactgcac agccactcag       840
     atgtcccttt ccagatgcta gacagcaata gcggtctgag ctccgagaag atcagctaca       900
     acccctggag cctgcgctgc cacaagcagc agctgagccg catgcgctcc gagtccaagg       960
     accgaaaact ctacaagttc ctcctgcttg agaacgtggt acaccacttc aagtacccct      1020
     gtgtgctgga cttgaagatg ggtacccggc agcatggcga tgatgcttca gctgaaaagg      1080
     ctgcccggca gatgaggaag tgtgagcaga gcacgtcggc cacgctgggg gtcagggtct      1140
     gtggcatgca ggtgtaccag ctggacacag gtcattacct ctgcaggaat aagtactatg      1200
     gccgtggact ctccatcgag ggcttccgca atgcgctcta tcagtacctg cacaatggct      1260
     tggaccttcg acgtgacctt tttgagccaa tcctgagcaa actgcggggc ctcaaagccg      1320
     tactggagcg gcaggcctcc taccgcttct actccagctc cctgcttgtc atctatgatg      1380
     gcaaggagtg ccggtctgag ctacgtctca agcacgtgga catggggctc cctgaggtgc      1440
     caccaccctg tggccccagc accagtccta gcagcaccag tcttgaggct ggcccctctt      1500
     ctccgcccaa ggtggatgtt cgcatgattg actttgcaca cagcacattc aagggcttcc      1560
     gggatgaccc cactgttcac gatgggccag acagaggcta tgtgtttggc ttggagaatc      1620
     ttatcagcat catggagcag atgcgggatg agaaccagta ggccctgtgc tgggcctagg      1680
     acccccctcc tctccaccca caggcaggga ccattgctct gaacttgctg tgaggacaca      1740
     cagacttgct tttaaagggt tatatttctc tttggtgtaa actaaaagaa atgtttttag      1800
     ctgtagcctg gaatccatat atataaagta gaggagggca gaacatttgt cctctcagcc      1860
     aggctcctta gctctgtggc tgtgactgct gtgtccaggc tgtctcagga aggaagaggt      1920
     ggccccagtg ggcttgacag caaagagaat gaatgccttg aactttggtc tcccttgcct      1980
     aaggcgtttg ggatctgtgg ctgtggggct ctgctgatgg tgaggtgaag ccctcggctg      2040
     gcacacggtc tccatgccca atcatccctt atttcccaga actggggaag gttaagtgcc      2100
     cacgtcctga gggccatctt agtttcgtgc cagtgctgta acagatgcct cagggcatta      2160
     gagggctagc tgcacagacg gactcaccct tgggtctgat tttggcatgg ggctagatcg      2220
     gtgaaactga gctaaggcca actcagcaga gggcaggccc tgggctccct aggcacccac      2280
     tggcatgtaa ccctgttcct ctctccacaa ctcgagccag cctcttgctg ggatccctga      2340
     cctaaggagg cctcatagcc tcctatccca ctaagatggg cacagctgtt tgctgaggag      2400
     agccagtgtc ccaggaggcc taagggcggg actttagtgg ctctggccca gacagtattt      2460
     gcagttctgg gctctgggtg gcatcccttc ctcacctggg gcagctgtgc tgcttgtggg      2520
     tgggctgctg ctcccagggc tcaggaaccg tggtccgctc agggtcttgt cttctccagg      2580
     ccaagctcaa ggcagcagcc ctgtatgtgg tgctccaggc tctaggcctg gagggagaac      2640
     tttaaacttg tttgctttta gggacatagg gccctgggca caggtgccca gcgtctgctg      2700
     agagctttga ttaatcctgg ggtttgtcag taagtccatt tgtccacctg ctagcccctg      2760
     tctcatggtg agctttctgg agtatagcct tgttggttag tatatattga tttccttcat      2820
     gcttccccca gcagtcttct cctttccttt tctgaggtga gtctgctcct gtgcccctcc      2880
     tcagcaggtt ctgctgttac aaacctggtg gccaaatgat tcatagtggt gtttacctgc      2940
     tagcccagtg gccttcttgt gggcctgggg tatggccttc agcaccaacg gtgggtaatg      3000
     aaggctcagg gttgaccctg acctattgct tttatttctg ctaccagtcc tttcatggta      3060
     gagacctgct gctgcctgta acatagtgtc cgacaggtta cactacacca atcattgcca      3120
     aggtgagcaa cagtctccaa gtctatcact tctaacatgt ctctgttttg gcatttgaag      3180
     gtaatcctgc caacctttga gagaaactgt taacgaatgg cataatttcc aggttcttag      3240
     agatgcagcc tctgaaaagg gttctgtgac ggatccaagt cagtcttctg accctggtgc      3300
     cattggtggg caggttccca ttccttaggg ccgggaggca cggcttggcc catctctgct      3360
     tactaacacc tgtcttctgt ccagtagtag tgttgcttgt gccatgcagg cagcaagtgt      3420
     taattagcgt ggacaccttt tctttggcag gatagaggtc aagagaggag tttggggcca      3480
     gcagagacct cctaggaatg tgctgtactt ccgatttacc agattttggg aggtgctgcc      3540
     cccattctgc tgcttctcaa gtagcaaggg agttggtagg cactgctcct gccactgcaa      3600
     gcgaggaaag gctgggattt gccgctgctc aagggcaggg cctcactttt cagcactttt      3660
     gatatctgga ggcccagctc tgttatctga taggtggtgg caagtgtgtg cgaacacttt      3720
     taccactgct cttctgcctg tcccaggcta gagccctgtc tttttcctga caggtcctgc      3780
     cttcccaatc atcaatttgg gaccaaagtg caactaggga tcatgggttg ggagctcaca      3840
     ttaccccttt ccattgtatt tcccgggcca agcccatacc agcccgggga gatgggtggg      3900
     agtgaaatgg gatgggtgct gctggaagag gaagggacca gtagagcaat gtccttgcct      3960
     gggattctac ccctctcagc tgtgggccgt gcagtggtgt ggggattcat tctctcctag      4020
     gggcaaggga cctgggctcg gacagtatcc gttcagtatc cgctgctcat tcgctcacat      4080
     ctggccacgt gcacgttccc tagatgcaaa ctgctttgaa ctttacagct atataagttg      4140
     gttgtgtgtg tgtgctcatt ttaaaaacta cattttaacg aggaaaaagg agaacctggg      4200
     gaaatttcct ttgcttctgt ggaggaaatg taagacttgg aattctggaa attgttatct      4260
     gctcctcttt cctggaagct acacacccta agacctgcgc ctggatgcat acgtggctcc      4320
     actggcgctt aggcgcgctt gcattttccc caggtcttct gtgtggtgga gaggagtgct      4380
     tggcccaagc cggccctttt ctgtacaccc agcgctatcc gcccgcttgt gtctggtcgt      4440
     atacgtcaaa ataaagcctc tagaaactg                                        4469
//


spacer
spacer