Dbfetch

ID   AK172609; SV 1; linear; mRNA; HTC; MUS; 1449 BP.
XX
AC   AK172609;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830219E03 product:UDP-N-acetyl-alpha-D- galactosamine:polypeptide
DE   N-acetylgalactosaminyltransferase 10, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1449
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 055f88e5ed4363a663799bb554aaefe2.
DR   Ensembl-Gn; ENSMUSG00000020520; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018338; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018307; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018276; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018278; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018090; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017654; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018064; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018173; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018165; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018248; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018772; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017427; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017702; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000108846; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0029217; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0029178; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0029145; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0029159; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0028961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0029661; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0028637; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0028881; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029024; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0028995; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0029125; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0028984; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0029695; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0028341; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0028453; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830219E03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1449
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830219E03"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             98..502
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 10 (MGD|MGI:1890480
FT                   GB|BC060617, evidence: BLASTN, 100%, match=496)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5ST18"
FT                   /db_xref="MGI:MGI:1890480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ST18"
FT                   /protein_id="BAE43090.1"
FT                   /translation="MRRKEKRLLQAVALALAALVLLPNVGLWALYRERQPDGSPGGLGA
FT                   AVAPAAVQELHSRQKKTFFLGAEQRLKDWHNKEAIRRDAQRVGYGEQGKPYPMTDAERV
FT                   DQAYRENGFNIYVSDKISLNRSLPDIRHPK"
XX
SQ   Sequence 1449 BP; 314 A; 397 C; 430 G; 308 T; 0 other;
     ggcgcggccg ctactgctgg ccgaactgct gccgccgccg ggtggacggg cggacgcgca        60
     aagccggggg cgggcgcggc ggggcggacc ggccccgatg aggcgcaaag agaagcggct       120
     cttgcaggcg gtggctctgg ctctggcggc cctggtcctg ctgcccaacg tggggctttg       180
     ggctctgtac cgcgagcggc agcccgacgg cagccctggg ggattggggg cggcggtggc       240
     ccccgcggcg gttcaggaat tacacagtcg acaaaaaaag acatttttct tgggagctga       300
     acaaaggctg aaggactggc ataacaagga ggctatcagg agggacgcac agcgcgtagg       360
     atatggagaa caggggaagc cttaccccat gaccgatgcc gagagagtgg accaggcgta       420
     ccgggaaaat ggatttaaca tctacgtcag tgataaaatc tccctgaatc gctctctccc       480
     cgatatccgg cacccaaagt gagtgtcacg tctctcatct tctgctgtct aactaaggga       540
     ttttgcccat tgctctaggt tgcacgagct tcattaaaac aagcattcac ctgaggtgct       600
     gccagccggc tgccaggtgg aacagagccc ctgcagaggc ttgagcagtc agaccctctg       660
     cagcatggag ctggagtgtc tggggatggt gcaccagggt gatccttccc tcagaatagg       720
     aaccagcaat tctccaagtg tctgcagaac actgccatcg gttcacctgg gcatttgtca       780
     cacttgcgag agtgggtgag ggccatgtgt gccacaacac atgtggaggt cagaggagcc       840
     tctggtgtag gtctttgcct tctgctttgt tcaagacagg gtctgattgt tattcaccat       900
     gtatacaaca ggctagctgc tgccggctcc caggagttct cccctcctcc catctcactg       960
     gtggagtgct gggatgacag gtggtccaca cccgtgtcta gcttttttgt agattctagg      1020
     aattcaaacc caggtcgtct ggcttgctca gcagtcactt cccccactgg gctctctcca      1080
     gctcactcct gtgcctccat gcagattaac tgtcctgaag ctctggaggc catcagccag      1140
     cagtgtcctc agaagtcctg aaaggtgact ctgatgcaga cagagggtag aataggaaac      1200
     cacacaggca ggaagcctcg cttggaagac aggctgtccc ccgggaccag accctttgca      1260
     tcaaactctt acacggagga gacagacgag gaacccaggg tgcttgcctg ttggacttac      1320
     tgtttcatga tctagaatct tctgctgaca tacgagagtg ttgttcagcc acactgatat      1380
     ttccaggttc agatcagtga gctgacaatg accaagcctg tgcctgacac caggagcacc      1440
     tatggtcgt                                                              1449
//