Dbfetch

ID   AK172222; SV 1; linear; mRNA; HTC; MUS; 4521 BP.
XX
AC   AK172222;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830107C10 product:phosphatidylinositol 3-kinase catalytic delta
DE   polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4521
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0f5d4ebba39078329783db4c8f18f23c.
DR   Ensembl-Gn; ENSMUSG00000039936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105690; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177654; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830107C10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4521
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830107C10"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             183..3326
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide (MGD|MGI:1098211 GB|AK040867, evidence: BLASTN,
FT                   99%, match=4490)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3T9Y0"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1098211"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T9Y0"
FT                   /protein_id="BAE42890.1"
FT                   /translation="MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTI
FT                   KQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAR
FT                   EGDRVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWL
FT                   QYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALR
FT                   KKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSS
FT                   ILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMK
FT                   LVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVE
FT                   KAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGT
FT                   VRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEEQLQLREILER
FT                   RGSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQLSQMLYLLCSWPE
FT                   LPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKF
FT                   LLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSK
FT                   LKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCT
FT                   FMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLR
FT                   MTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEAL
FT                   DRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINR
FT                   ERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGL
FT                   PELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ"
XX
SQ   Sequence 4521 BP; 1007 A; 1333 C; 1281 G; 900 T; 0 other;
     ggccagctcc gcggacccag ctgctggacc gacatctaag gagctgagag ccaggcagaa        60
     gtgggatgaa gcccgctgat gccaaagtac ctttaatctc ccaggcagag gggccttggc       120
     tggtggtcct tcttggccca taccaaacag gaaaacagac ctcagagaag taacacaaca       180
     ggatgccccc tggggtggac tgccccatgg agttctggac caaagaggag agccagagcg       240
     tggttgttga cttcttgctg cccacagggg tctacttgaa cttccccgtg tcccgcaatg       300
     ccaacctcag caccatcaag caggtgctgt ggcaccgtgc acagtatgag ccactcttcc       360
     acatgctcag tgaccccgag gcctatgtgt tcacctgtgt gaaccagacg gcggagcagc       420
     aggagttgga ggatgagcag cggaggctgt gcgacatcca gcccttcctg cccgtgctgc       480
     gcctcgtggc ccgagagggg gaccgcgtga agaagctcat taactcccag atcagcctcc       540
     tcattggcaa aggtctccat gagtttgatt ccctgcggga cccggaagta aacgacttcc       600
     gcactaagat gcgccagttt tgtgaagagg ctgctgctca ccgccagcag ctgggctggg       660
     tggaatggct gcagtacagc ttccccctgc agctggagcc ctcagcaagg ggttggcggg       720
     ccggcttatt gcgtgtcagc aaccgagccc tgctggtcaa cgtgaagttc gagggcagtg       780
     aggagagctt caccttccag gtatccacca aggacatgcc cctggcactg atggcctgtg       840
     ccctccgaaa aaaggccaca gtgttccggc agcctctggt ggagcagcct gaggaatatg       900
     ccctgcaggt gaacgggagg cacgaatacc tctacggcaa ctacccgctc tgccactttc       960
     agtacatctg cagctgccta cacagcgggc tgacccctca tctgaccatg gtccactcct      1020
     cctccatcct tgctatgcgg gatgagcaga gcaatcctgc cccccaagta cagaaaccac      1080
     gtgccaaacc tcccccgatc cctgccaaga agccctcctc tgtgtccctg tggtccctgg      1140
     aacagccatt ctccattgag ctgatcgagg gccgaaaagt gaatgctgac gagcggatga      1200
     agctggttgt tcaggccggg ctcttccatg gcaatgagat gctgtgcaag actgtgtcaa      1260
     gctcggaggt gaatgtatgc tcagagcccg tgtggaagca gcgactggag ttcgatatca      1320
     gcgtctgtga cctcccgcgc atggctcgac tctgttttgc tctctatgcc gtcgtggaga      1380
     aggctaagaa ggcacgctcc acaaagaaga agtctaagaa ggcggactgc cccatcgctt      1440
     gggccaacct catgctattc gactacaaag atcagctcaa gacgggggag cgctgcctct      1500
     acatgtggcc ctctgtccca gatgagaagg gagagctgct gaatcctgcg ggtacagtgc      1560
     gcgggaaccc caacacggag agtgccgctg ccctggtcat ctacctgcct gaggtggccc      1620
     cccaccctgt gtacttcccc gctctggaga agatcctgga gctggggcgt cacggggagc      1680
     gtgggcgcat cacggaggag gagcagctgc agctgcggga gatcctggaa cggcggggat      1740
     ccggggaact gtacgaacat gagaaggacc tggtgtggaa gatgcgccac gaagtccagg      1800
     agcatttccc agaggcgctg gcccgcctgc tgctggtcac caagtggaat aaacacgagg      1860
     atgtggccca gctgtcccag atgctctatt tgctgtgctc ctggcccgag ctgcctgtgc      1920
     tgagcgccct ggaacttctg gactttagct ttcccgactg ctacgtgggc tccttcgcca      1980
     tcaagtccct tcggaagctg acggacgatg agctcttcca gtaccttctg cagctggtgc      2040
     aagtgctcaa atatgagtcc tacctggact gcgagctgac caaattcttg ctgggccgag      2100
     ccctggctaa ccgcaagatc ggacacttcc tgttctggca cctccgctct gagatgcacg      2160
     taccatcagt ggctctgcgg tttggtctca tcatggaagc ctactgcaga ggcagcaccc      2220
     accacatgaa ggtgctgatg aagcaggggg aagcactgag caagcttaag gcactgaatg      2280
     actttgtgaa ggtgagttcc cagaagacca ccaagcccca aaccaaggag atgatgcata      2340
     tgtgcatgcg ccaggagacc tacatggagg ccctgtccca cctgcagtct ccactcgacc      2400
     ccagcaccct gctggaggaa gtctgtgtgg agcagtgcac cttcatggac tccaaaatga      2460
     agcccctgtg gatcatgtac agcagcgagg aggcgggcag tgctggcaac gtgggcatca      2520
     tctttaagaa cggggatgac ctccgccagg acatgctgac tctgcagatg atccagctca      2580
     tggacgtcct gtggaagcag gagggcctgg acctgaggat gacgccctac ggctgcctcc      2640
     ccaccgggga ccgcacaggt ctcatcgagg tggtcctcca ctcggacacc atcgccaaca      2700
     tccagctgaa caaaagcaac atggcggcca cagctgcctt caacaaggac gccctgctca      2760
     actggctcaa gtccaagaac cctggggagg ccctggatcg ggccattgag gaattcaccc      2820
     tctcctgtgc tggctactgt gtggccacat atgttctggg catcggtgac cggcacagcg      2880
     acaacatcat gatcagagag agtgggcagc tcttccacat tgattttggc cactttctgg      2940
     ggaacttcaa gaccaagttt ggaatcaacc gagagcgcgt ccccttcatt ctcacctacg      3000
     actttgtcca cgtgatccag caggggaaga ctaacaacag tgagaagttt gaaaggttcc      3060
     gcggctactg tgaacgagcc tataccatcc tgcggcgcca cgggctgctt ttcctccatc      3120
     tcttcgccct gatgcgggcc gcaggtctgc ctgagcttag ctgctccaaa gatatccagt      3180
     atctcaagga ctctctggca ctggggaaga cggaggaaga ggcgctaaag cacttccggg      3240
     tgaagttcaa cgaagctctc cgagaaagct ggaaaaccaa agtcaactgg ctggcgcaca      3300
     atgtgtccaa ggataaccga cagtaggagg cgccccctgg tggtcatacg gcggttccct      3360
     cctggctttc agccctagag gtaaaaggac agtcctggag accaggcatg tccagtggtc      3420
     accaaaggga ccccagagcc tgaactgtcc ctcatgggga agaaccacac cactgcttct      3480
     tgtttacact ggtaatttat ttatgactcg aaatgtttaa ggaacagaat agccataaat      3540
     ggaagtgcat ttctgtgcag gggaggggtg atgtcctcat gatgtcatcc ccggtcagca      3600
     ctgtaacagc accttgagga tcgaacccct agtcttccaa cctgtgggtc ttggcccagc      3660
     aaggacagtt cttggggcct tcttcccagg ctcccagcag gctgcctgga acaagcctgg      3720
     cggtcacctg gtgcctccat cctcagctca cctccggcca ccgttgtgtg gcctacccaa      3780
     ccaagcctcc ggcagctctt gaggaagcca ggagcttccc tctagactca ggcacacttg      3840
     ctcggcactg ctgaagcgac ctcttgggtt tgggtacggg aacgccctca cctctcattt      3900
     gcgggtaaga acacgatatg tagactctgt cccttacccc gatggctggg gtaagggacc      3960
     tggcctccac tacagttagt gtattccagg ccttgaagca ctcagaccgg tgccccattt      4020
     agctccgtgt ggtcacgaat caagacgaag ggccagccag aattgaagtc ctcttcgaag      4080
     ttcgtgtgag gggcacacaa ggcagcttta tggacggaca ggactgatct cttccagagc      4140
     tgaaatcgca gaaggcagct ggggagctag gctcgaaaag tgtgagcaag gacgagaacg      4200
     gaattcagtg tagtctgggc agtcagagga actcgagaaa cgcagtctcg gcctcctccc      4260
     agggatccaa acgccagcca cccacccggc ttttagagag cccagctcag gggtcgcacg      4320
     tgcttatcgt cccaccccaa gcacatctcc atgtatcagc tgccacctca ggacctggat      4380
     ctcccggtag cattctgaga ctttgagaac catcaccgct gtctcgccag cagcccagaa      4440
     catggctcaa ggagcccctt catgttgatg agcccagggt ccagcagtga gcggtggtgc      4500
     ctccgcagca cccgctgaac c                                                4521
//