Dbfetch

ID   AK172080; SV 1; linear; mRNA; HTC; MUS; 1766 BP.
XX
AC   AK172080;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830035G01 product:vesicle-associated membrane protein, associated
DE   protein B and C, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1766
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 3164fc104e6435103c2362c7a1023b80.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830035G01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1766
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830035G01"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..627
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="vesicle-associated membrane protein, associated
FT                   protein B and C (MGD|MGI:1928744 GB|NM_019806, evidence:
FT                   BLASTN, 99%, match=1299)"
FT                   /db_xref="GOA:Q3TA54"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="InterPro:IPR030226"
FT                   /db_xref="MGI:MGI:1928744"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TA54"
FT                   /protein_id="BAE42816.1"
FT                   /translation="QHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPN
FT                   SGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMD
FT                   SKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDDTEVKKEEDGLRV
FT                   RKAMPSNSPVAALAATGKEEGLSARLLALVVLFFIVGVIIGKIAL"
FT   regulatory      1744..1749
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1766
FT                   /note="putative"
XX
SQ   Sequence 1766 BP; 456 A; 407 C; 486 G; 417 T; 0 other;
     caacacgagc tcaagttccg aggtcccttc actgatgttg tcaccaccaa cctaaagctt        60
     ggcaacccaa cagaccgaaa tgtgtgtttt aaagtgaaga ccacagcacc tcgcaggtac       120
     tgcgtgcggc ccaacagtgg ggtcattgat gccggggcct ctctcaatgt gtctgtgatg       180
     ttacagcctt tcgattatga tcccaatgag aaaagtaaac acaagtttat ggttcagtct       240
     atgtttgctc cgcctgacac ttctgatatg gaggcagtat ggaaggaggc aaaaccggaa       300
     gaccttatgg attcaaaact tagatgtgtg tttgaattgc cagcagaaaa tgctaaacca       360
     catgatgtag aaataaataa aatcatacct acgagtgcat ccaagacaga agcaccggca       420
     gccgcaaagt ccctgacatc gcccctcgat gacacagaag taaagaagga agaagacgga       480
     cttcgggtga ggaaggcgat gccgagcaac agccccgtgg cggctctggc ggccactggg       540
     aaggaggagg gcctgagcgc ccggctgctg gccctggtgg ttctgttctt tatcgttggt       600
     gtcattatag ggaagattgc cttgtagggg ccgcatgcga aggatggcag gttggattga       660
     tggatctacc acaccatggg attcaaattt atcataacca tgcgtaaaaa gaaattaatg       720
     tatgacggca tctcacaggt cttgccttta aatacccctc cccatgcaca cacaaatgca       780
     cacacaaata tagcataata taatgatctt ttagaaagtt aaaaatgtat agggaatgga       840
     tggggaaaga atggtctgtt gccgtaggac gggccgtgat taaccacagt ggcatcttgt       900
     agctgtcacg ctcaattcgg gtaggcctgg gcacgtgttg ctagatcact ctcttaaagc       960
     aagaagctcc tcctcgcatg ttggggctgg cccgtgggag cgggagtcct gcaaggtggg      1020
     gcgagctgtc tttttcttac ccacgtggct tccccaggcc tgctgttctg tccaggcatc      1080
     gtctcctcag gcctacagag ctgcaggtgc caaagtgcat tgcacagagg ccacatctcg      1140
     tgtacctgtg ggtcgtgtgg gagagacatg agtggaccag cgggtccaac acagggaaat      1200
     ccaagtctgt gctctgttct cttgaaggga ccaagctaaa ttaccgctgg ttcaagtagt      1260
     gaaccgagtt gttctcggag atggctgatg cacatgtaac ctatttcatc tcgtgtgttc      1320
     ctgctgccac cagagcacag gcagtgagtg ctgcagaccg ccagtgagga gctgctgctg      1380
     tgggctctgg aggtctgagg gaaggggagg gtctgagtca ggaagtgttt tgttgtaggt      1440
     cagtaatagc tgccctgagg aggaacgctc tttttaatga cagtcagctc tggattaccc      1500
     agtcttctag attgccctac catccatcct tctaaaacat aggccagcct tgacctgccc      1560
     ttctcaggat gagtgagtca ggctgcagaa ggtgaagggc atagaggggg tggggtgggg      1620
     tgggggagcc ctcagcaaat ccatctgctg gtgatgaaga gtcctgactg tgaattaatt      1680
     tcatgccata aaagaccgat ccagttctgc tcaactatgt agcatcttaa aggaagagat      1740
     taaaataaag ccccaaatta agagcc                                           1766
//