spacer

EBI Dbfetch

ID   AK171880; SV 1; linear; mRNA; HTC; MUS; 2795 BP.
XX
AC   AK171880;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830016L10 product:inositol polyphosphate-5-phosphatase A, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2795
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000025477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106098; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830016L10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2795
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830016L10"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             258..1496
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="inositol polyphosphate-5-phosphatase A
FT                   (MGD|MGI:2686961 GB|BC056341, evidence: BLASTN, 99%,
FT                   match=2791)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q7TNC9"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="MGI:MGI:2686961"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TNC9"
FT                   /protein_id="BAE42716.1"
FT                   /translation="MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVLHTHK
FT                   PHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTAL
FT                   GSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDYFPECKWSR
FT                   KGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGVRHKALGYVLDRIIDQRF
FT                   EKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVVLQL
FT                   EKKLFDYFNQDVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYM
FT                   NTRCPAWCDRILMSLSAKELVLKSESEEKVATYDHIGPNVCMGDHKPVFLAFRIAPGAG
FT                   KPHAHVHKCCVVQ"
FT   polyA_signal    2778..2783
FT                   /note="putative"
FT   polyA_site      2795
FT                   /note="putative"
XX
SQ   Sequence 2795 BP; 656 A; 766 C; 732 G; 641 T; 0 other;
     gttcgggtct aatggctgcg cgcgggccgc tgtgaggcgc ggcggcgagc gggcgcgggg        60
     ccgcggagca gcgaagagcc gcgaccgcga ggctggagcc ccggccaggc ccggtccgac       120
     ccgccaagcc cgcgatgcgc ccctgtgctg tcccccggcg cagctgacgc cccgcggccc       180
     cgcgagaccc cagccctacc ggccccgcag gaagcggccg ccgccaccca gtccagagcc       240
     cgctccgccc gggcaccatg gcggggaagg cggccgcccc cggcaccgcg gtcctgctgg       300
     tcacggccaa cgtgggctcg ctcttcgacg acccagaaaa cctgcagaag aactggcttc       360
     gggaatttta ccaggtcctg cacacacaca agcctcactt catggccttg cactgccaag       420
     aatttggagg gaaaaactac gaggcctcca tgtcccatgt ggacaaattt gtcaaagaac       480
     tactatccag tgacgcaatg aaagaataca acagggcgcg tgtctacctg gatgaaaact       540
     acaagtcaca ggaacacttc acggcactag gaagctttta ttttcttcac gaatccttaa       600
     aaaacatcta ccagtttgac tttaaagcta agaagtataa aaaagtcact ggcaaggaga       660
     tctattcgga cactttggag agcacaccca tgctggagaa ggagaagttc ccacaggact       720
     actttcctga gtgcaaatgg tcaagaaaag gcttcatcag gacgcggtgg tgcattgctg       780
     actgtgcctt cgacttggtg aacattcatc tttttcatga tgcatccaac ttagtggcct       840
     gggagacaag cccctcagtg tactccggtg tcaggcacaa ggctctgggc tatgtgctgg       900
     acagaatcat cgaccagcga tttgagaaag tttcctactt tgtcttcggt gatttcaact       960
     tccgcctgga ttccaagtct gtcgtagaga cactctgcac aaaggccaca atgcagacag      1020
     tccgcgctgc cgataccaat gaagttgtaa agttgatatt tcgggagtca gacaatgacc      1080
     ggaaggtcgt gctccagttg gaaaagaagc tcttcgacta cttcaaccag gatgtcttcc      1140
     gggacaacaa cggcactgcg ctcttggaat ttgacaagga gttgtctgtc tttaaggaca      1200
     gactgtatga actggacatc tcattccccc ccagctaccc gtacagtgag gactccagcc      1260
     agggagaaca gtacatgaac acgagatgcc ctgcttggtg tgatcgcatc ctcatgtccc      1320
     tgtctgccaa ggagctggtt cttaagtcag agagcgagga gaaggttgcc acctacgacc      1380
     acatcgggcc taatgtctgc atgggagacc acaagccggt gttcctggcc ttccgaatcg      1440
     cacctggggc aggtaaacct cacgcccatg tacacaagtg ttgtgtcgtg cagtgacgtg      1500
     gtgggaagag gtgccagcgc cgcgagagga tcctcgagag gcctccctgt agcagtgtat      1560
     ccaactcatc ctcctaacag ctgcatcgga accgcccaag cctcacctgc tagacggccg      1620
     gccccacact tcgcttcagc ctccggacct ccggaaagcc tcacatacct cactgtcgtg      1680
     tctgtcacgt gacattgtag acatattggg tgtaatcaag ccacagtcct attgccaaaa      1740
     ctctaacaga cagcagagcg cctgtatttt agacttcaca gttttccatt tttaacaatt      1800
     gtctgtggag gaagcttctc catttagagc cccaagtgtc cagcgtccct ctctgccagg      1860
     aggagtgtgc cgggcactag cccaggcagc caggctgcca cgtgtgccca agcccgaggc      1920
     ctgaggtctg actctactgc catgttacgt ggcgtgagaa tcacactgca gctgctttcc      1980
     atttttatat atataaatac atataaatat atacttttta aaaataattt ataaatctta      2040
     ccaaaactta tgctgaatat actttccagt atgagtgcac gagtgtcctg agcaggcaga      2100
     accgcagtct agatgaatgg cgactccatc agcagtcggc acctgttcct gagacaaggc      2160
     ctagccagtg cccagggcga ggggccctgt gatctgcctg tactagcagt ttgtcactct      2220
     tctgcctttt ctgtgtaata ttaagaactg aatgtgaagt ttatagctag cctgggtgta      2280
     ccttttaaga attttgtaaa ctgttttgtc tgtcttttgt taccgtttta tggtgccaag      2340
     tagcctacat taaaaccata atcttgtggg agaattagaa gtagcctcgt ccacttccca      2400
     cagattgctt ctagcatggg ctgtgtgtaa acctggcaga aaagcgacgg gtgatgctgg      2460
     gcacagcctg ttgcctggac tagcacccag cactgagaac cacggaaggc gcctgcggag      2520
     cctgctgagg aaacacagcg tgcttttatt gatttacttc tgaacactac agttcctgga      2580
     tggggcggag gcgcgagtta atgtcggttt ccctagaaat cactcaaggc cggcctgtgt      2640
     ccttgatgcc agggtcgggt ctgtgactgc catggtcgct gcttgccaat gtgccatgtc      2700
     cgcagcggtt gtccgtgggt tccagctgtg ggtccttccc gtgaaggcct ctggaagtga      2760
     ctgctcggtt cctaagcaat aaaattgatc atggc                                 2795
//


spacer
spacer