Dbfetch

ID   AK171826; SV 1; linear; mRNA; HTC; MUS; 2238 BP.
XX
AC   AK171826;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830012O10 product:interleukin 21 receptor, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2238
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 097be5b2a93d2cba8ae3e0c3aad440f7.
DR   Ensembl-Gn; ENSMUSG00000030745; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032969; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032952; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032957; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032667; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033463; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031995; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032640; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032792; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032745; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032886; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032777; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033483; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031703; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032108; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033000; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0086380; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0086463; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0086402; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0086424; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085986; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086919; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0086501; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085926; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0086123; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085964; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0086158; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0086005; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0087212; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085914; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0085026; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830012O10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2238
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830012O10"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             378..1967
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="interleukin 21 receptor (MGD|MGI:1890475
FT                   GB|AB049137, evidence: BLASTN, 98%, match=2191)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TAI3"
FT                   /db_xref="InterPro:IPR003531"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="MGI:MGI:1890475"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TAI3"
FT                   /protein_id="BAE42685.1"
FT                   /translation="MPRGPVAALLLLILHGAWSCLDLTCYTDYLWTITCVLETRSPNPS
FT                   ILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGN
FT                   NSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNL
FT                   RDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVI
FT                   FQTQAGEPEAGWDPHMLLLLAVLIIVLVFMGLKIHLPWRLWKKIWAPVPTPESFFQPLY
FT                   REHSGNFKKWVNTPFTASSIELVPQSSTTTSALHLSLYPAKEKKFPGLPGLEEQLECDG
FT                   MSEPGHWCIIPLAAGQAVSAYSEERDRPYGLVSIDTVTVGDAEGLCVWPCSCEDDGYPA
FT                   MNLDAGRESGPNSEDLLLVTDPAFLSCGCVSGSGLRLGGSPGSLLDRLRLSFAKEGDWT
FT                   ADPTWRTGSPGGGSESEAGSPPGLDMDTFDSGFAGSDCGSPVETDEGPPRSYLRQWVVR
FT                   TPPPVDSGAQSS"
FT   regulatory      2220..2225
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2238
FT                   /note="putative"
XX
SQ   Sequence 2238 BP; 476 A; 633 C; 600 G; 529 T; 0 other;
     tcttctcctg tggtgtgcct cacggtcact tgcttgtctg accgcaagtc tgcccatccc        60
     tggggcagcc aactggcctc agcccgtgcc ccaggcgtgc cctgtctctg tctggctgcc       120
     ccagccctac tgtcttcctc tgtgtaggct ctgcccagat gcccggctgg tcctcagcct       180
     caggactatc tcagcagtga ctcccctgat tctggacttg cacctgactg aactcctgcc       240
     cacctcaaac cttcacctcc caccaccacc actccgagtc ccgctgtgac tcccacgccc       300
     aggagaccac ccaagtgccc cagcctaaag aatggctttc tgagaaagac cctgaaggag       360
     taggtctggg acacagcatg ccccggggcc cagtggctgc cttactcctg ctgattctcc       420
     atggagcttg gagctgcctg gacctcactt gctacactga ctacctctgg accatcacct       480
     gtgtcctgga gacacggagc cccaacccca gcatactcag tctcacctgg caagatgaat       540
     atgaggaact tcaggaccaa gagaccttct gcagcctaca caggtctggc cacaacacca       600
     cacatatatg gtacacgtgc catatgcgct tgtctcaatt cctgtccgat gaagttttca       660
     ttgtcaatgt gacggaccag tctggcaaca actcccaaga gtgtggcagc tttgtcctgg       720
     ctgagagcat caaaccagct ccccccttga acgtgactgt ggccttctca ggacgctatg       780
     atatctcctg ggactcagct tatgacgaac cctccaacta cgtgctgagg ggcaagctac       840
     aatatgagct gcagtatcgg aacctcagag acccctatgc tgtgaggccg gtgaccaagc       900
     tgatctcagt ggactcaaga aacgtctctc ttctccctga agagttccac aaagattcta       960
     gctaccagct gcaggtgcgg gcagcgcctc agccaggcac ttcattcagg gggacctgga      1020
     gtgagtggag tgaccccgtc atctttcaga cccaggctgg ggagcccgag gcaggctggg      1080
     accctcacat gctgctgctc ctggctgtct tgatcattgt cctggttttc atgggtctga      1140
     agatccacct gccttggagg ctatggaaaa agatatgggc accagtgccc acccctgaga      1200
     gtttcttcca gcccctgtac agggagcaca gcgggaactt caagaaatgg gttaataccc      1260
     ctttcacggc ctccagcata gagttggtgc cacagagttc cacaacaaca tcagccttac      1320
     atctgtcatt gtatccagcc aaggagaaga agttcccggg gctgccgggt ctggaagagc      1380
     aactggagtg tgatggaatg tctgagcctg gtcactggtg cataatcccc ttggcggctg      1440
     gccaagcggt ctcagcctac agtgaggaga gagaccggcc atatggtctg gtgtccattg      1500
     acacagtgac tgtgggagat gcagagggcc tgtgtgtctg gccctgtagc tgtgaggatg      1560
     atggctatcc agccatgaac ctggatgctg gccgagagtc tggccctaat tcagaggatc      1620
     tgctcttggt cacagaccct gcttttctgt cttgcggctg tgtctcaggt agtggtctca      1680
     ggcttggagg ctccccaggc agcctactgg acaggttgag gctgtcattt gcaaaggaag      1740
     gggactggac agcagaccca acctggagaa ctgggtcccc aggagggggc tctgagagtg      1800
     aagcaggttc cccccctggt ctggacatgg acacatttga cagtggcttt gcaggttcag      1860
     actgtggcag ccccgtggag actgatgaag gaccccctcg aagctatctc cgccagtggg      1920
     tggtcaggac ccctccacct gtggacagtg gagcccagag cagctagcat ataataacca      1980
     gctatagtga gaagaggcct ctgagcctgg catttacagt gtgaacatgt aggggtgtgt      2040
     gtgtgtgtgt gtgtgtgtgt gtcttgggtt gtgtgttagc acatccatgt tgggatttgg      2100
     tctgttgcta tgtattgtaa tgctaaattc tctacccaaa gttctaggcc tacgagtgaa      2160
     ttctcatgtt tacaaacttg ctgtgtaaac cttgttcctt aatttaatac cattggttaa      2220
     ataaaattgg ctgcaacc                                                    2238
//