spacer

EBI Dbfetch

ID   AK171725; SV 1; linear; mRNA; HTC; MUS; 1551 BP.
XX
AC   AK171725;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830007A17 product:adenylosuccinate lyase, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1551
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fb0de7df7957e4089d860011ea2d45f1.
DR   Ensembl-Gn; ENSMUSG00000022407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023043; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830007A17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1551
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830007A17"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             40..1494
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adenylosuccinate lyase (MGD|MGI:103202 GB|BC020187,
FT                   evidence: BLASTN, 100%, match=1546)"
FT                   /note="putative"
FT                   /db_xref="GOA:P54822"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="MGI:MGI:103202"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54822"
FT                   /protein_id="BAE42633.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
XX
SQ   Sequence 1551 BP; 369 A; 401 C; 450 G; 331 T; 0 other;
     ggttgctggt gtccgccgcg tcctggtcgc gtgttgaaaa tggctgcatc cggcgaccct        60
     ggcagtgctg aaagttaccg ttctccgctg gcggcccgct acgccagccg cgagatgtgt       120
     ttcttgttca gcgacaggta caagttccag acgtggcggc agctgtggct gtggctggcg       180
     gaggccgaac agacgctggg tttgcctatc acagatgaac aaatccagga gatgaagtcg       240
     aacctgaaca acattgactt ccagatggca gctgaggaag agaagcgcct gcggcacgac       300
     gtgatggctc acgtgcacac gttcggccac tgctgtccga aagctgcggg cattattcat       360
     ctgggcgcca cctcctgcta tgtcggagac aatacggacc tgattattct gagaaatgca       420
     tttgacctac ttttgccaaa gcttgctaga gtgatctcga ggcttgccga ctttgctaag       480
     gatcgtgctg atctgcccac gttaggtttc acacactttc agcctgctca gctgaccacg       540
     gttgggaaac gatgctgcct ttggattcaa gatctctgca tggatctcca gaacttgaag       600
     cgtgtccggg atgagctgcg cttccgagga gtaaagggca ccactggcac gcaggccagc       660
     ttcctgcagc tcttcgaggg ggatcaccag aaggtggagc agctggacaa gatggtgaca       720
     gaaaaggcag ggtttaaaag agccttcatc atcacaggac agacgtacac acggaaagtg       780
     gacatcgaag tgctgtctgt gctggccagc ttaggagcat cggtgcacaa gatttgcact       840
     gacatacgcc tgctggcaaa cctgaaggag atggaggagc cctttgagaa acagcagatt       900
     ggctccagtg cgatgccgta caagcggaac cccatgcgct ccgaacgttg ctgcagcctg       960
     gcccgtcacc tgatggccct taccatggac ccactacaga cagcgtctgt gcagtggttt      1020
     gaacgtactc tggatgacag tgccaaccga cggatctgtt tggctgaagc gtttctcact      1080
     gcagatacta tattaaacac cctacagaac atttctgaag gattggtggt gtaccccaaa      1140
     gtaattgaac ggcgcattcg gcaagagctg cctttcatgg ccacagagaa catcatcatg      1200
     gcaatggtga aagccggggg cagccgacag gactgccatg agaaaattag agtgctttcc      1260
     cagcaggcag ctgctgtggt caagcaggaa ggaggtgaca atgaccttat agagcgcatc      1320
     cgggcagatg cctacttcag ccccatccac tcacagctgg agcacttgct ggacccctct      1380
     tctttcactg gccgagcacc ccagcaggtc cacagattcc tggaagagga agtgcgcccc      1440
     ctgctaaagc cctatgggaa tgagatggcg gtgaaagcag agctgtgtct gtagagtagg      1500
     agagctgagg agaacccggt tacagtgatt agagcttgct gattacagtg t               1551
//


spacer
spacer