Dbfetch

ID   AK171482; SV 1; linear; mRNA; HTC; MUS; 1317 BP.
XX
AC   AK171482;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 9)
XX
DE   Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F730219P09 product:glycogen synthase kinase 3 beta,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1317
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ffeb0b79e38d089c88ae45558eda6069.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F730219P09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1317
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F730219P09"
FT                   /cell_type="B6-derived CD11 +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             1043..>1317
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glycogen synthase kinase 3 beta (MGD|MGI:1861437
FT                   GB|NM_019827, evidence: BLASTN, 98%, match=1316)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TB31"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033573"
FT                   /db_xref="MGI:MGI:1861437"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TB31"
FT                   /protein_id="BAE42483.1"
FT                   /translation="MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPG
FT                   QGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR"
XX
SQ   Sequence 1317 BP; 304 A; 372 C; 367 G; 273 T; 1 other;
     gggggaaggg ctaggcggct gcgcagacgg cgcgcctcgc acagagcagc ccccgacccg        60
     gccgaatgcg ggcttgtgtc gccgccgtcg ccgccgcctg ggccgagtga caaaggaagg       120
     aaggcagcaa ggaggagccg gccttgcagc cgctgacagg gcttcgggct ccgggcacag       180
     cgcggacact tcccgagcag ccgctgagca aaggcgaggg gcggaggccg gccgtgccgg       240
     ggccacggac gggggagggg accccgaggg acggaagcgg ttgcctggtt cccatgtccc       300
     cggcgtatgg ggagcagtca gggagccgct gcctggggtc tgaagggagc tgcctccgcc       360
     gccgctgccg ccatggccgc tggatccagc caccgcctgc agctgctcct ggcgcatgag       420
     gagaggagcc gccgccaccg cccgccgctg actcgcgact gcgctgccct ccggttcacc       480
     cggccgccgc cgccgtcaga ccgccggatc ccgctgctgc cggagccgca gcgtttgccg       540
     tcgcatctnc gagccatctc ctccctcctt ccccatcccc ttctcttcaa gcgtgagggc       600
     tcgtgatcct tccgccgctt cccttcttca ttgactcgga aaaaaatccc cgaggaaaaa       660
     tataatactc agagtactta ttttcaatca agtatttgcc ctcgttcacg tgatatatat       720
     atatttttaa ggattccact ccaccctttt tctcctcttc caggaaaggg aggtgaaaga       780
     attgtatttt tctcccagct ctaaatcatc tatgtgttaa atatccgtac cgatctgtct       840
     tgaagaaata catagctcct tttttttttc cttcttctta aatagctata caaaaggagt       900
     gaaaagccaa gagaacgaag tctttctttc tctttcttgc gggagaactt aatgctgcat       960
     ttatcattaa cctagcaccc taacataaaa caaaaggaag aaaaggatta aggaaggaaa      1020
     aggtgattca agaagagcca tcatgtcggg gcgaccgaga accacctcct ttgcggagag      1080
     ctgcaagcca gtgcagcagc cttcagcttt tggtagcatg aaagttagca gagataaaga      1140
     tggcagcaag gtaaccacag tagtggcaac tcctggccag ggtcctgaca ggccacagga      1200
     agtcagttat acagacacga aagtgattgg aaatggatca tttggtgtgg tatatcaagc      1260
     caaactttgt gattctggag aactggttgc catcaagaaa gttctacagg acaagcg         1317
//