spacer

EBI Dbfetch

ID   AK171360; SV 1; linear; mRNA; HTC; MUS; 2820 BP.
XX
AC   AK171360;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F730042A11 product:inositol
DE   polyphosphate-5-phosphatase A, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2820
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ed98e319f5d67f87f61165ee4673ab05.
DR   Ensembl-Gn; ENSMUSG00000025477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106098; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F730042A11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2820
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F730042A11"
FT                   /cell_type="B6-derived CD11 +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             282..1520
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="inositol polyphosphate-5-phosphatase A
FT                   (MGD|MGI:2686961 GB|BC056341, evidence: BLASTN, 99%,
FT                   match=2817)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q7TNC9"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="MGI:MGI:2686961"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TNC9"
FT                   /protein_id="BAE42408.1"
FT                   /translation="MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVLHTHK
FT                   PHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTAL
FT                   GSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDYFPECKWSR
FT                   KGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGVRHKALGYVLDRIIDQRF
FT                   EKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVVLQL
FT                   EKKLFDYFNQDVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYM
FT                   NTRCPAWCDRILMSLSAKELVLKSESEEKVATYDHIGPNVCMGDHKPVFLAFRIAPGAG
FT                   KPHAHVHKCCVVQ"
FT   polyA_signal    2802..2807
FT                   /note="putative"
FT   polyA_site      2820
FT                   /note="putative"
XX
SQ   Sequence 2820 BP; 657 A; 772 C; 746 G; 645 T; 0 other;
     ggtcggcggc tgcgggaact ttcccggcgg gtctaatggc tgcgcgcggg ccgctgtgag        60
     gcgcggcggc gagcgggcgc ggggccgcgg agcagcgaag agccgcgacc gcgaggctgg       120
     agccccggcc aggcccggtc cgacccgcca agcccgcgat gcgcccctgt gctgtccccc       180
     ggcgcagctg acgccccgcg gccccgcgag accccagccc taccggcccc gcaggaagcg       240
     gccgccgcca cccagtccag agcccgctcc gcccgggcac catggcgggg aaggcggccg       300
     cccccggcac cgcggtcctg ctggtcacgg ccaacgtggg ctcgctcttc gacgacccag       360
     aaaacctgca gaagaactgg cttcgggaat tttaccaggt cctgcacaca cacaagcctc       420
     acttcatggc cttgcactgc caagaatttg gagggaaaaa ctacgaggcc tccatgtccc       480
     atgtggacaa atttgtcaaa gaactactat ccagtgacgc aatgaaagaa tacaacaggg       540
     cgcgtgtcta cctggatgaa aactacaagt cacaggaaca cttcacggca ctaggaagct       600
     tttattttct tcacgaatcc ttaaaaaaca tctaccagtt tgactttaaa gctaagaagt       660
     ataaaaaagt cactggcaag gagatctatt cggacacttt ggagagcaca cccatgctgg       720
     agaaggagaa gttcccacag gactactttc ctgagtgcaa atggtcaaga aaaggcttca       780
     tcaggacgcg gtggtgcatt gctgactgtg ccttcgactt ggtgaacatt catctttttc       840
     atgatgcatc caacttagtg gcctgggaga caagcccctc agtgtactcc ggtgtcaggc       900
     acaaggctct gggctatgtg ctggacagaa tcatcgacca gcgatttgag aaagtttcct       960
     actttgtctt cggtgatttc aacttccgcc tggattccaa gtctgtcgta gagacactct      1020
     gcacaaaggc cacaatgcag acagtccgcg ctgctgatac caatgaagtt gtaaagttga      1080
     tatttcggga gtcagacaat gaccggaagg tcgtgctcca gttggaaaag aagctcttcg      1140
     actacttcaa ccaggatgtc ttccgggaca acaacggcac tgcgctcttg gaatttgaca      1200
     aggagttgtc tgtctttaag gacagactgt atgaactgga catctcattc ccccccagct      1260
     acccgtacag tgaggactcc agccagggag aacagtacat gaacacgaga tgccctgctt      1320
     ggtgtgatcg catcctcatg tccctgtctg ccaaggagct ggttcttaag tcagagagcg      1380
     aggagaaggt tgccacctac gaccacatcg ggcctaatgt ctgcatggga gaccacaagc      1440
     cggtgttcct ggccttccga atcgcacctg gggcaggtaa acctcacgcc catgtacaca      1500
     agtgttgtgt cgtgcagtga cgtggtggga agaggtgcca gcgccgcgag aggatcctcg      1560
     agaggcctcc ctgtagcagt gtatccaact catcctccta acagctgcat cggaaccgcc      1620
     caagcctcac ctgctagacg gccggcccca cacttcgctt cagcctccgg acctccggaa      1680
     agcctcacat acctcactgt cgtgtctgtc acgtgacatt gtagacatat tgggtgtaat      1740
     caagccacag tcctattgcc aaaactctaa cagacagcag agcgcctgta ttttagactt      1800
     cacagttttc catttttaac aattgtctgt ggaggaagct tctccattta gagccccagg      1860
     tgtccagcgt ccctctctgc caggaggagt gtgccgggca ctagcccagg cagccaggct      1920
     gccacgtgtg cccaagcccg aggcccgagg tctgactcta ctgccatgtt acgtggcgtg      1980
     agaatcacac tgcagctgct ttccattttt atatatataa atacatataa atatatactt      2040
     tttaaaaata atttataaat cttaccaaaa cttatgctga atatactttc cagtatgagt      2100
     gcacgagtgt cctgagcagg cagaaccgca gtctagatga atggcgactc catcagcagt      2160
     cggcacctgt tcctgagaca aggcctagcc agtgcccagg gcgaggggcc ctgtgatctg      2220
     cctgtactag cagtttgtca ctcttctgcc ctttctgtgt aatattaaga actgaatgtg      2280
     aagtttatag ctagcctggg tgtacctttt aagaattttg taaactgttt tgtctgtctt      2340
     ttgttaccgt tttatggtgc caagtagcct acattaaaac cataatcttg tgggagaatt      2400
     agaagtagcc tcgtccactt cccacagatt gcttctagca tgggctgtgt gtaaacctgg      2460
     cagaaaagcg acgggtgatg ctgggcacag cctgttgcct ggactagcac ccagcactga      2520
     gaaccacgga aggcgcctgc ggagcctgct gaggaaacac agcgtgcttt tattgattta      2580
     gttctgaaca ctacagttcc tggatggggc ggaggtgcga gttaatgtcg gtttccctag      2640
     aaatcactca aggccggcct gtgtccttga tgccagggtc gggtctgtga ctgccatggt      2700
     cgctgcttgc caatgtgcca tgtccgcagc ggttgtccgt gggttccagc tgtgggtcct      2760
     tcccgtgaag gcctctggaa gtgactgctc ggttcctaag caataaaatt gatcatggtg      2820
//


spacer
spacer