spacer

EBI Dbfetch

ID   AK171283; SV 1; linear; mRNA; HTC; MUS; 2934 BP.
XX
AC   AK171283;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630324P12 product:protein phosphatase 1, catalytic
DE   subunit, beta isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2934
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ebaa0a933e2cc1982f0325f62e888d95.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131300; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630324P12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2934
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630324P12"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             256..1239
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871 GB|NM_172707, evidence: BLASTN,
FT                   99%, match=2775)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAE42366.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLRKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSASNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2934 BP; 802 A; 511 C; 641 G; 980 T; 0 other;
     ggacgcggcc cggttcctga cgcggcccgg ttcctggggg cctgcttgtt tatttattta        60
     tttccagtgg gcgccgccag cgtgtgcgcg cgctgtcgct gctcggcggg gagggggtgg       120
     ggggagggcc cgcgcccggg gggagttgga gccggggtcg aaacgccgcg tgactcgtag       180
     gtgagaacgc cgagccgccg ccgccgccga gaagccctgt taacgcttta gggaggagag       240
     tctggtgccg acaagatggc ggacggggag ctgaacgtgg acagcctcat cacccgcctg       300
     ctggaggtac gaggatgtcg tccaggaaag attgtacaaa tgactgaagc agaagtccga       360
     gggttgtgta tcaagtctcg tgaaatcttt ctcagccagc ctattctttt ggaattggaa       420
     gcaccactga agatttgtgg agacattcat ggacaatata cagacttact aagattattt       480
     gaatatggag gttttccacc agaagccaac tatcttttct taggagatta tgtggacaga       540
     ggaaagcagt ctttggaaac catctgtttg ctattggctt acaaaatcaa atacccggag       600
     aacttctttc ttctaagagg aaaccatgag tgtgctagca tcaatcgcat ttatggattc       660
     tacgatgagt gtaaacgaag atttaatatt aaattgcgga agacattcac tgattgtttt       720
     aactgtctgc ctatagctgc tattgttgat gagaaaatct tctgttgtca tggaggactg       780
     tcaccagacc tacaatctat ggaacagatt cggagaatta tgagacccac tgacgtacct       840
     gatacaggtt tgctttgtga cttactgtgg tccgacccag ataaggatgt gcaaggctgg       900
     ggagaaaatg accgtggtgt ttcttttact tttggagctg atgtagtcag taaatttctg       960
     aatcgtcatg atttagactt gatttgtcga gctcatcagg tggtggaaga cggatatgaa      1020
     ttttttgcta aacgacagtt ggtaacctta ttttctgcct caaattactg tggcgagttt      1080
     gacaatgctg gtggtatgat gagtgtggat gagactttga tgtgttcatt ccagatattg      1140
     aaaccatctg aaaagaaagc taagtaccag tatggtgggc tgaattctgg acgtcctgtc      1200
     actccgcctc gaacagctaa tccaccgaag aaaaggtgaa gacaggaatt ctagaaagag      1260
     aaaccatcag atttgttaag gacatacttc ataatatata agtgtgcact gtaaaaccat      1320
     ccagccattc gacacccttt atgatgtcac acctttaact taaggagacg gtaaaggatc      1380
     ttaaattttt ttctaataga aagatgtgct acactgtatt gtaataagta tactctgtta      1440
     taatattcaa caaaattaaa tccaaattca aaagtatcca ttaaagttct atcttctcat      1500
     atcacagttt ttaaagttga aaagcatccc agttaaacta gccctgttag tgacccagat      1560
     gaaagcatga agatccatct gtgtaatgtg gttttagtgg tgcttggttg tttcattatt      1620
     ttgagcttgt tttgttttgt ttgtttttgc tagaataatg gcatctactt ttcctatttt      1680
     tccctaaaca tttttaaaag tgaaaatggg aagagcttta aagacattca ccaactattc      1740
     ttttccttta cttatctact taagtaactg ttggatctta ctaagaaaac ttacccctca      1800
     ttacagtaaa aaggaacttt agaggtcgat aggttttaaa aatatacaaa ctatctgatc      1860
     cattgatttt aatcaaacag tttgactggg caaactttgc agctgataat gagtatttcg      1920
     ctttttacaa aattgccact gatttggatt tgtgcactct aatctttaat ttattgatgc      1980
     tctattgtgc agtagcattt catttaagat aaggctcata tagtaatatc caaaactagt      2040
     tggtaatgtg attatgtggt actttggctt tgggttctaa ttcgcacgaa acaccttttg      2100
     gcatgcttaa ctttctggta ttaccctcac ctgcattggt tttgtttttt ggggtttttg      2160
     ttgtttgttt gtttttagat tcacagaaca tgagaatcct ttttgacaag ccttggatag      2220
     ctggctctct tctttccctc tctctatgtg aaggatgtat ttaaatgaac gctggtcagt      2280
     gggacatttg tcagctctga atattgggtg cttcactaat aattgccatg tgaatgttgt      2340
     tttgactgta gggctatgtc actaaagatt tttactctgc gttttcataa tcaaaggtca      2400
     tgatgtgtat agacatgctt tgtagtgaag tatagtagca ataatttctg tatgtgatca      2460
     agagtttatt gcattatttc tttccctgtt ctcttttttt ttttttttaa gggttagcat      2520
     taacaaatgt caaggagtag caaagtcaac aaagatttta gaaggaggag gaactaagag      2580
     catacacaga cttatgattc tttggatgtg acacttattg gatgtgattc taaagtcttt      2640
     tattgaacat tgtcaaattc gtacgcttca taggatggac ataatgttta tataatgccc      2700
     ttcttatgtg ttaccataga tgtgtgaaac cttatagcgt ccttgaaagt gttaaattga      2760
     gaactctgtt aacattttat ggattgacac attatattac tgcaagtaac atttgatttt      2820
     cagcacagtg caaaagttct ttaaaatgca tatgtctttt tttttttcta attccatttt      2880
     gtttaaagca cattttaaat gtagttttct catttagtaa aagttgtcta attg            2934
//


spacer
spacer