spacer

EBI Dbfetch

ID   AK171025; SV 1; linear; mRNA; HTC; MUS; 4899 BP.
XX
AC   AK171025;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630220A05 product:phosphatidylinositol 3-kinase
DE   catalytic delta polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4899
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7f9548be364f8ae3f2e5980b1e3fc507.
DR   Ensembl-Gn; ENSMUSG00000039936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118704; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630220A05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4899
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630220A05"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             289..3429
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide (MGD|MGI:1098211 GB|AK040867, evidence: BLASTN,
FT                   99%, match=4761)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TBW3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="MGI:MGI:1098211"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TBW3"
FT                   /protein_id="BAE42194.1"
FT                   /translation="MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTI
FT                   KQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAR
FT                   EGDRVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWL
FT                   QYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALR
FT                   KKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSS
FT                   ILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMK
FT                   LVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVE
FT                   KAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGT
FT                   VRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEELQLREILERR
FT                   GSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQLSQMLYLLCSWPEL
FT                   PVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFL
FT                   LGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKL
FT                   KALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTF
FT                   MDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRM
FT                   TPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALD
FT                   RAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRE
FT                   RVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLP
FT                   ELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ"
FT   polyA_signal    4877..4882
FT                   /note="putative"
FT   polyA_site      4899
FT                   /note="putative"
XX
SQ   Sequence 4899 BP; 1079 A; 1427 C; 1387 G; 1006 T; 0 other;
     gtcctgccct caggcccggc cggctgcaca cggccgccgg gaggctggcg ccctccggtc        60
     acttcgggac cctcccgccg tgtcccccgg gcaactgtct ccagggagac ggagcccgcc       120
     cctgccaccg acaccggaca tctaaggagc tgagagccag gcagaagtgg gatgaagccc       180
     gctgatgcca aagtaccttt aatctcccag gcagaggggc cttggctggt ggtccttctt       240
     ggcccatacc aaacaggaaa acagacctca gagaagtaac acaacaggat gccccctggg       300
     gtggactgcc ccatggagtt ctggaccaaa gaggagagcc agagcgtggt tgttgacttc       360
     ttgctgccca caggggtcta cttgaacttc cccgtgtccc gcaatgccaa cctcagcacc       420
     atcaagcagg tgctgtggca ccgtgcacag tatgagccac tcttccacat gctcagtgac       480
     cccgaggcct atgtgttcac ctgtgtgaac cagacggcgg agcagcagga gttggaggat       540
     gagcagcgga ggctgtgcga catccagccc ttcctgcccg tgctgcgcct cgtggcccga       600
     gagggggacc gcgtgaagaa gctcattaac tcccagatca gcctcctcat tggcaaaggt       660
     ctccatgagt ttgattccct gcgggacccg gaagtaaacg acttccgcac taagatgcgc       720
     cagttttgtg aagaggctgc tgctcaccgc cagcagctgg gctgggtgga atggctgcag       780
     tacagcttcc ccctgcagct ggagccctca gcaaggggtt ggcgggccgg cttattgcgt       840
     gtcagcaacc gagccctgct ggtcaacgtg aagttcgagg gcagtgagga gagcttcacc       900
     ttccaggtat ccaccaagga catgcccctg gcactgatgg cctgtgccct ccgaaaaaag       960
     gccacagtgt tccggcagcc tctggtggag cagcctgagg aatatgccct gcaggtgaac      1020
     gggaggcacg aatacctcta cggtaactac ccgctctgcc actttcagta catctgcagc      1080
     tgcctacaca gcgggctgac ccctcatctg accatggtcc actcctcctc catccttgct      1140
     atgcgggatg agcagagcaa tcctgccccc caagtacaga aaccacgtgc caaacctccc      1200
     ccgatccctg ccaagaagcc ctcctctgtg tccctgtggt ccctggaaca gccattctcc      1260
     attgagctga tcgagggccg aaaagtgaat gctgacgagc ggatgaagct ggttgttcag      1320
     gccgggctct tccatggcaa tgagatgctg tgcaagactg tgtcaagctc ggaggtgaat      1380
     gtatgctcag agcccgtgtg gaagcagcga ctggagttcg atatcagcgt ctgtgacctc      1440
     ccgcgcatgg ctcgactctg ttttgctctc tatgccgtcg tggagaaggc taagaaggca      1500
     cgctccacaa agaagaagtc taagaaggcg gactgcccca tcgcttgggc caacctcatg      1560
     ctattcgact acaaagatca gctcaagacg ggggagcgct gcctctacat gtggccctct      1620
     gtcccagatg agaagggaga gctgctgaat cctgcgggta cagtgcgcgg gaaccccaac      1680
     acggagagtg ccgctgccct ggtcatctac ctgcctgagg tggcccccca ccctgtgtac      1740
     ttccccgctc tggagaagat cctggagctg gggcgtcacg gggagcgtgg gcgcatcacg      1800
     gaggaggagc tgcagctgcg ggagatcctg gaacggcggg gatccgggga actgtacgaa      1860
     catgagaagg acctggtgtg gaagatgcgc cacgaagtcc aggagcattt cccagaggcg      1920
     ctggcccgcc tgctgctggt caccaagtgg aataaacacg aggatgtggc ccagctgtcc      1980
     cagatgctct atttgctgtg ctcctggccc gagctgcctg tgctgagcgc cctggaactt      2040
     ctggacttta gctttcccga ctgctacgtg ggctccttcg ccatcaagtc ccttcggaag      2100
     ctgacggacg atgagctctt ccagtacctt ctgcagctgg tgcaagtgct caaatatgag      2160
     tcctacctgg actgcgagct gaccaaattc ttgctgggcc gagccctggc taaccgcaag      2220
     atcggacact tcctgttctg gcacctccgc tctgagatgc acgtaccatc agtggctctg      2280
     cggtttggtc tcatcatgga agcctattgc agaggcagca cccaccacat gaaggtgctg      2340
     atgaagcagg gggaagcact gagcaagctt aaggcactga atgactttgt gaaggtgagt      2400
     tcccagaaga ccaccaagcc ccaaaccaag gagatgatgc atatgtgcat gcgccaggag      2460
     acctacatgg aggccctgtc ccacctgcag tctccactcg accccagcac cctgctggag      2520
     gaagtctgtg tggagcagtg caccttcatg gactccaaaa tgaagcccct gtggatcatg      2580
     tacagcagcg aggaggcggg cagtgctggc aacgtgggca tcatctttaa gaacggggat      2640
     gacctccgcc aggacatgct gactctgcag atgatccagc tcatggacgt cctgtggaag      2700
     caggagggcc tggacctgag gatgacgccc tacggctgcc tccccaccgg ggaccgcaca      2760
     ggtctcatcg aggtggtcct ccactcggac accatcgcca acatccagct gaacaaaagc      2820
     aacatggcgg ccacagctgc cttcaacaag gacgccctgc tcaactggct caagtccaag      2880
     aaccctgggg aggccctgga tcgggccatt gaggaattca ccctctcctg tgctggctac      2940
     tgtgtggcca catatgttct gggcatcggt gaccggcaca gcgacaacat catgatcaga      3000
     gagagtgggc agctcttcca cattgatttt ggccactttc tggggaactt caagaccaag      3060
     tttggaatca accgagagcg cgtccccttc attctcacct acgactttgt ccacgtgatc      3120
     cagcagggga agactaacaa cagtgagaag tttgaaaggt tccgcggcta ctgtgaacga      3180
     gcctatacca tcctgcggcg ccacgggctg cttttcctcc atctcttcgc cctgatgcgg      3240
     gccgcaggtc tgcctgagct tagctgctcc aaagatatcc agtatctcaa ggactctctg      3300
     gcactgggga agacggagga agaggcgcta aagcacttcc gggtgaagtt caacgaagct      3360
     ctccgagaaa gctggaaaac caaagtcaac tggctggcgc acaatgtgtc caaggataac      3420
     cgacagtagg aggcgccccc tggtggtcat acggcggttc cctcctggct ttcagcccta      3480
     gaggtaaaag gacagtcctg gagaccaggc atgtccagtg gtcaccaaag ggaccccaga      3540
     gcctgaactg tccctcatgg ggaagaacca caccactgct tcttgtttac actggtaatt      3600
     tatttatgac tcgaaatgtt taaggaacag aatagccata aatggaagtg catttctgtg      3660
     caggggaggg gtgatgtcct catgatgtca tccccggtca gcactgtaac agcaccttga      3720
     ggatcgaacc cctagtcttc caacctgtgg gtcttggccc agcaaggaca gttcttgggg      3780
     cctttttccc aggctcccag caggctgcct ggaacaagcc tggcggtcac ctggtgcctc      3840
     catcctcagc tcacctccgg ccaccgttgt gtggcctacc caaccaagcc tccggcagct      3900
     cttgaggaag ccaggagctt ccctctagac tcaggcacac ttgctcggca ctgctgaagc      3960
     gacctcttgg gtttgggtac gggaacgccc tcacctctca tttgcgggta agaacacgat      4020
     atgtagactc tgtcccttac cccgatggct ggggtaaggg acctggcctc cactacagtt      4080
     agtgtattcc aggccttgaa gcactcagac cggtgcccca tttagctccg tgtggtcacg      4140
     aatcaagacg aagggccagc cagaattgaa gtcctcttcg aagttcgtgt gaggggcaca      4200
     caaggcagct ttatggacgg acaggactga tctcttccag agctgaaatc gcagaaggca      4260
     gctggggagc taggctcgaa aagtgtgagc aaggacgaga acggaattca gtgtagtctg      4320
     ggcagtcaga ggaactcgag aaacgcagtc tcggcctcct cccagggatc caaacgccag      4380
     ccacccgccc ggcttttaga gagcccagct caggggtcgc acgtgcttat cgtcccaccc      4440
     caagcacatc tccatgtatc agctgccacc tcaggacctg gatctcccgg tagcattctg      4500
     agactttgag aaccatcacc gctgtctcgc cagcagccca gaacatggct caaggagccc      4560
     cttcatgttg atgagcccag ggtccagcag tgagcggtgg tgcctccgca gcacccgctg      4620
     aacccctagt ctgccccacc aactctgaaa taggaaacgt gtctgtgtgt gtgtatgtat      4680
     gtatgccatg ttatttattg aaaagagtct aggtgctctc tggtgtggct gcagattctg      4740
     cacaggctcg gcctttctgg gttgggtgtg tacttggctg gaagacgggt tttttgttaa      4800
     gttttttcct ctcattgatg ggggctgaga ccagtttgtg caaccttgac acaacaggta      4860
     aagacaggtg aaaagaaata aaaacgtttt tatgttctc                             4899
//


spacer
spacer