Dbfetch

ID   AK170965; SV 1; linear; mRNA; HTC; MUS; 2312 BP.
XX
AC   AK170965;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630213P21 product:glycogen synthase kinase 3 beta,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2312
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5e5da0ed87f8c3248789728c21a9e945.
DR   Ensembl-Gn; ENSMUSG00000022812; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022808; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022773; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022745; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022774; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022538; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023221; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022064; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022509; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022641; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022616; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022709; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022635; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023236; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021804; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022108; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023507; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0044379; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0044354; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0044328; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0044330; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0044072; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0044811; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0044182; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0043986; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0044137; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0044092; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0044211; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0044071; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0044870; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0043765; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0043445; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630213P21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2312
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630213P21"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             973..2235
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glycogen synthase kinase 3 beta (MGD|MGI:1861437
FT                   GB|NM_019827, evidence: BLASTN, 99%, match=2294)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5KU03"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033573"
FT                   /db_xref="MGI:MGI:1861437"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KU03"
FT                   /protein_id="BAE42146.1"
FT                   /translation="MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPG
FT                   QGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKL
FT                   DHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMY
FT                   QLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYY
FT                   RAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQI
FT                   REMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFF
FT                   DELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASD
FT                   TNAGDRGQTNNAASASASNST"
XX
SQ   Sequence 2312 BP; 586 A; 633 C; 574 G; 519 T; 0 other;
     gtcttgtgtc gccgccgtcg ccgccgcctg ggccgagtga caaaggaagg aaggcagcaa        60
     ggaggagccg gccttgcagc cgctgacagg gcttcgggct ccgggcacag cgcggacact       120
     tcccgagcag ccgctgagca aaggcgaggg gcggaggccg gccgtgccgg ggccacggac       180
     gggggagggg accccgaggg acggaagcgg ttgcctggtt cccatgtccc cggcgtatgg       240
     ggagcagtca gggagccgct gcctggggtc tgaagggagc tgcctccgcc gccgctgccg       300
     ccatggccgc tggatccagc caccgcctgc agctgctcct ggcgcaatga ggagaggagc       360
     cgccgccacc gcccgccgct gactcgcgac tgcgctgccc tccggttcac ccggccgccg       420
     ccgccgtcag accgccggat cccgctgctg ccggagccgc agcgtttgcc gtcgcatctc       480
     cgagccatct cctccctcct tcccatcccc cttctcttca agcgtgaggc tcgtgatcct       540
     tccgccgctt cccttcttca ttgactcgga aaaaaatccc cgaggaaaaa tataatactc       600
     agagtactta ttttcaatca agtatttgcc ctcgttcacg tgatatatat atatttttaa       660
     ggattccact ccaccctttt tctcctcttc caggaaaggg aggtgaaaga attgtatttt       720
     tctcccagct ctaaatcatc tatgtgttaa atatccgtac cgatctgtct tgaagaaata       780
     catagctcct tttttttttc cttcttctta aatagctata caaaaggagt gaaaagccaa       840
     gagaacgaag tctttctttc tctttcttgc gggagaactt aatgctgcat ttatcattaa       900
     cctagcaccc taacataaaa caaaaggaag aaaaggatta aggaaggaaa aggtgattca       960
     agaagagcca tcatgtcggg gcgaccgaga accacctcct ttgcggagag ctgcaagcca      1020
     gtgcagcagc cttcagcttt tggtagcatg aaagttagca gagataaaga tggcagcaag      1080
     gtaaccacag tagtggcaac tcctggccag ggtcctgaca ggccacagga agtcagttat      1140
     acagacacga aagtgattgg aaatggatca tttggtgtgg tatatcaagc caaactttgt      1200
     gattctggag aactggttgc catcaagaaa gttctacagg acaagcgatt taagaaccga      1260
     gagctccaga tcatgagaaa gctagaccac tgtaacatag tccgactgcg gtatttcttc      1320
     tactcgagtg gcgagaagaa agatgaggtc taccttaacc tggtgctgga ctatgttccg      1380
     gagacagtgt acagagtcgc cagacactat agtcgagcca agcagacact ccctgtgatc      1440
     tatgtcaagt tgtatatgta tcagctgttc agaagtctag cctatatcca ttcctttgga      1500
     atctgccatc gagacattaa accacagaac ctcttgttgg atcctgatac agctgtatta      1560
     aaactctgtg actttggaag tgcaaagcag ctggtccgag gagagcccaa tgtttcatat      1620
     atctgttctc ggtactacag ggcaccagag ttgatctttg gagccactga ttacacgtcc      1680
     agtatagatg tatggtctgc aggctgtgtg ttggctgaat tgttgctagg acaaccaata      1740
     tttcctgggg acagtggtgt ggatcagttg gtggaaataa taaaggtcct aggaacacca      1800
     acaagggagc aaattagaga aatgaaccca aattatacag aattcaaatt ccctcaaatc      1860
     aaggcacatc cttggacaaa ggtcttccgg ccccgaactc caccagaggc aattgcactg      1920
     tgcagccgtc tgctggagta cacacctacc gcccggctaa caccactgga agcttgtgca      1980
     cattcatttt tcgatgaatt gcgggaccca aatgtcaaac taccaaatgg gcgagacaca      2040
     cctgcactct tcaactttac cactcaagaa ctgtcaagta acccccctct ggccaccatc      2100
     cttatccctc cacatgctcg gattcaggcc gctgcttcac cgcctgccaa cgccacagca      2160
     gcctcagata ctaatgctgg agaccgtgga cagaccaata acgccgcttc tgcatcagct      2220
     tccaactcca cctgaacagc ccccaggagc cagctgcgcg ggaaagacca gcacttactt      2280
     gagtgccact cagcaacact ggtcacgttt gg                                    2312
//