spacer

EBI Dbfetch

ID   AK170888; SV 1; linear; mRNA; HTC; MUS; 1086 BP.
XX
AC   AK170888;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630207J03 product:CDP-diacylglycerol synthase
DE   (phosphatidate cytidylyltransferase) 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1086
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 96b2e538463f34cc7f88523387463635.
DR   Ensembl-Gn; ENSMUSG00000058793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110158; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630207J03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1086
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630207J03"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             186..575
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="CDP-diacylglycerol synthase (phosphatidate
FT                   cytidylyltransferase) 2 (MGD|MGI:1332236 GB|AK050589,
FT                   evidence: BLASTN, 99%, match=756)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q6PBC0"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="MGI:MGI:1332236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PBC0"
FT                   /protein_id="BAE42095.1"
FT                   /translation="MTELRQRVVREDAPPEDKESESEAKLDGETASDSESRAETAPLPT
FT                   SVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKC
FT                   FHEIITIGYNVYHSYDLPWFRTLSW"
FT   polyA_signal    1068..1073
FT                   /note="putative"
FT   polyA_site      1086
FT                   /note="putative"
XX
SQ   Sequence 1086 BP; 214 A; 279 C; 334 G; 259 T; 0 other;
     gttagggcgg cggcagcggt gctgggcggg gccggcctcg gggctagtgg cgctgctgca        60
     ggggctgtgc gaggcacggt ggggctgcga ggtgctcggg cccgcccaga gcccgtgctc       120
     actgagccga cccccgcggc caccgtgctg ctcactaggg gtgacgtcgc gccggggtcc       180
     ccagcatgac cgaactacgg cagagggttg tccgcgagga cgcacctccg gaggacaagg       240
     aatcagagtc cgaagcaaag ctagatggag agacagcgtc tgacagcgag agccgagcgg       300
     aaacagctcc cctaccaacc tccgtagatg acaccccaga ggtccttaac agggcccttt       360
     ccaacctgtc ctcaaggtgg aagaactggt gggtgagagg catcctgact ttggccatga       420
     tcgcgttttt cttcattatc atttacctgg gaccaatggt tttgatgatg attgttatgt       480
     gtgtccagat taagtgtttc catgaaataa tcactattgg ctacaatgta taccactcct       540
     acgacctgcc ctggttcagg accctcagct ggtaagctct ctgctccact ggggcaggca       600
     ggcaccttgc ctgatttgag tgatgtgatt tgtggcaggt acttacagtg ctggtggaga       660
     cattgccaca ggcttgcagg agattgagcc tggattgtat ggcacgtttg aggagacttg       720
     agtagctgag gacttcgtgt cgtctgtgac agatgtgtct atggttgggc ttagctcagc       780
     agaagggtcc ctgggctcct gcagccaggg actgtattgt gcatcgcacc cgaggtcagc       840
     gtgcttttta tgctgcagcc cagcgtgtca ctggagtcct ctgggagctg gcaggtcccg       900
     gtgccggtgt ggctgtctct ggaacttgat ttgctcatca ctacagcaga ctgttgaggt       960
     tactctcttt aaggcactcg gggccggcgt ggttcagatc tgagctcctt cagagactgc      1020
     tttttttttc cttctcctaa aaaggattgt ctaacagcaa actgctaaat aaagaactgt      1080
     agcacg                                                                 1086
//


spacer
spacer