spacer

EBI Dbfetch

ID   AK170870; SV 1; linear; mRNA; HTC; MUS; 1698 BP.
XX
AC   AK170870;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630206I18 product:activin A receptor, type II-like
DE   1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1698
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f39b95964cb2091ffcb7fd1cd0cbd83e.
DR   Ensembl-Gn; ENSMUSG00000000530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121718; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630206I18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1698
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630206I18"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             29..1537
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="activin A receptor, type II-like 1 (MGD|MGI:1338946
FT                   GB|NM_009612, evidence: BLASTN, 99%, match=1695)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61288"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338946"
FT                   /protein_id="BAE42083.1"
FT                   /translation="MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFC
FT                   QGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEA
FT                   TQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLIL
FT                   KASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHG
FT                   ESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEH
FT                   GSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSN
FT                   LQCCIADLGLAVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWA
FT                   FGLVLWEIARRTIINGIVEDYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADP
FT                   VLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSHNPEKPKVIH"
XX
SQ   Sequence 1698 BP; 362 A; 474 C; 506 G; 356 T; 0 other;
     gacatctctt ctcctatctc caaggaccat gaccttgggg agcttcagaa ggggcctttt        60
     gatgctgtcg gtggcctttg gcctaaccag gggagacttg gcgaagcctt ccaagctggt       120
     gaactgcact tgtgagagcc cacactgcaa gagaccattc tgccaggggt catggtgcac       180
     agtggtgctg gttcgggagc agggcaggca cccccaggtc tatcggggct gcgggagcct       240
     gaaccaggag ctctgcttgg gacgtcccac agagtttctg aaccatcact gctgctatag       300
     atccttctgc aaccacaacg tgtctctgat gctggaggcc acccaaactc cttcggagga       360
     gccagaagtt gatgcccatc tgcctctgat cctgggtcct gtgctggcct tgccggtcct       420
     ggtggccctg ggtgctctag gcttgtggcg tgtccggcgg aggcaggaga agcagcggga       480
     tttgcacagt gacctgggcg agtccagtct catcctgaag gcatctgaac aggcagacag       540
     catgttgggg gacttcctgg acagcgactg tactacgggc agcggctcgg ggctcccctt       600
     cttggtgcag aggacggtag ctcggcaggt tgcgctggta gagtgtgtgg gaaagggccg       660
     atatggtgag gtgtggcgcg gttcgtggca tggcgagagt gtggcggtca agattttctc       720
     ctcacgagat gagcagtcct ggttccggga gacggagatc tacaacacag ttctgcttag       780
     acacgacaac atcctaggct tcatcgcctc cgacatgact tcgcggaact cgagcacgca       840
     gctgtggctc atcacccact accatgaaca cggctccctc tatgactttc tgcagaggca       900
     gacgctggag ccccagttgg ccctgaggct agctgtgtcc gcggcctgcg gcctggcgca       960
     cctacatgtg gagatctttg gcactcaagg caaaccagcc attgcccatc gtgacctcaa      1020
     gagtcgcaat gtgctggtca agagtaactt gcagtgttgc attgcagacc tgggactggc      1080
     tgtgatgcac tcacaaagca gcgattacct ggatatcggc aacaaccccc gagtgggtac      1140
     caaaagatac atggcacccg aggtgctgga tgagcacatc cgcacagact gctttgagtc      1200
     gtacaagtgg acagacatct gggcctttgg cctagtgcta tgggagatcg cccggcggac      1260
     catcatcaat ggcattgtgg aggattacag gccacctttc tatgacatgg tacccaatga      1320
     ccccagtttt gaggacatga aaaaggtggt gtgcgttgac cagcagacac ccaccatccc      1380
     taaccggctg gctgcagatc cggtcctctc cgggctggcc cagatgatga gagagtgctg      1440
     gtaccccaac ccctctgctc gcctcaccgc actgcgcata aagaagacat tgcagaagct      1500
     cagtcacaat ccagagaagc ccaaagtgat tcactagccc agggccacca ggcttcctct      1560
     gcctaaagtg tgtgctgggg cagaagacat agcctgtctg ggtagaggga gtgaagagag      1620
     tgtgcacgct gccctgtgtg tgcctgctca gcttggctcc cagcccatcc agccaaaaat      1680
     acagctgagc tgaaatcc                                                    1698
//


spacer
spacer