spacer

EBI Dbfetch

ID   AK170781; SV 1; linear; mRNA; HTC; MUS; 3319 BP.
XX
AC   AK170781;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630119J11 product:ceroid-lipofuscinosis, neuronal
DE   2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3319
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 676f9cb6332896ade975b11be543d8fa.
DR   Ensembl-Gn; ENSMUSG00000030894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033184; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630119J11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3319
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630119J11"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             17..1705
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="ceroid-lipofuscinosis, neuronal 2 (MGD|MGI:1336194
FT                   GB|NM_009906, evidence: BLASTN, 99%, match=3314)"
FT                   /note="putative"
FT                   /db_xref="GOA:O89023"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="MGI:MGI:1336194"
FT                   /db_xref="UniProtKB/Swiss-Prot:O89023"
FT                   /protein_id="BAE42026.1"
FT                   /translation="MGLQARLLGLLALVIAGKCTYNPEPDQRWMLPPGWVSLGRVDPEE
FT                   ELSLTFALKQRNLERLSELVQAVSDPSSPQYGKYLTLEDVAELVQPSPLTLLTVQKWLS
FT                   AAGARNCDSVTTQDFLTCWLSVRQAELLLPGAEFHRYVGGPTKTHVIRSPHPYQLPQAL
FT                   APHVDFVGGLHRFPPSSPRQRPEPQQVGTVSLHLGVTPSVLRQRYNLTAKDVGSGTTNN
FT                   SQACAQFLEQYFHNSDLTEFMRLFGGSFTHQASVAKVVGKQGRGRAGIEASLDVEYLMS
FT                   AGANISTWVYSSPGRHEAQEPFLQWLLLLSNESSLPHVHTVSYGDDEDSLSSIYIQRVN
FT                   TEFMKAAARGLTLLFASGDTGAGCWSVSGRHKFRPSFPASSPYVTTVGGTSFKNPFLIT
FT                   DEVVDYISGGGFSNVFPRPPYQEEAVAQFLKSSSHLPPSSYFNASGRAYPDVAALSDGY
FT                   WVVSNMVPIPWVSGTSASTPVFGGILSLINEHRILNGRPPLGFLNPRLYQQHGTGLFDV
FT                   THGCHESCLNEEVEGQGFCSGPGWDPVTGWGTPNFPALLKTLLNP"
FT   polyA_signal    3291..3296
FT                   /note="putative"
FT   polyA_site      3319
FT                   /note="putative"
XX
SQ   Sequence 3319 BP; 818 A; 901 C; 680 G; 920 T; 0 other;
     gcgcttgaaa gccaaaatgg gactccaagc ccgcctccta gggctccttg ctctcgtcat        60
     cgccggcaaa tgcacttaca accctgagcc ggaccagcgg tggatgctgc ctccaggctg       120
     ggtgtccctg ggccgcgtgg atcccgagga agagctgagt ctcacttttg cgctgaaaca       180
     gcggaacctg gaaagactct cggagctggt gcaggctgtg tcggatccta gctctcctca       240
     atatggaaag tacctaaccc tggaggatgt agctgagctg gttcaaccat cacccctgac       300
     cctcctcact gtccaaaagt ggctctcagc agctggagcc cggaactgcg attcagtgac       360
     cacccaggac tttctgactt gctggctgag tgtccgacag gctgagctgc tgctcccagg       420
     agctgagttt catcgctatg tagggggacc tacaaagacc catgttataa ggtccccaca       480
     tccctaccag cttccccagg ccttggcccc tcatgtggat tttgtggggg ggctgcaccg       540
     tttcccccct tcatctccaa gacaacgtcc agaaccacaa caggtaggaa ctgttagcct       600
     gcacttggga gtgactccgt ctgtgctccg tcagcgatac aacctgacag ccaaagatgt       660
     gggctcaggc accaccaaca atagccaggc ctgtgcccag ttcctggaac agtacttcca       720
     taactcggat ctgactgagt tcatgcgcct attcggtggc agttttacac accaggcctc       780
     agtagcaaaa gttgttggaa agcaagggcg aggccgagct gggatcgagg ccagtctaga       840
     tgtggaatac ctgatgagtg ctggtgccaa tatctccact tgggtctaca gtagccctgg       900
     ccgccatgag gcacaggagc ccttcttaca atggctcctg cttcttagca atgagtcatc       960
     tttgccacat gtacatactg tgagttacgg agacgatgaa gactccctca gcagcatcta      1020
     catccagaga gtcaacactg agttcatgaa ggctgctgct cggggtctca ccctcctttt      1080
     tgcctcaggt gacactggag ctgggtgttg gtctgtctcc ggaagacaca agttccgccc      1140
     tagcttccct gcttccagcc cctatgttac tacagttgga ggaacctcct tcaagaatcc      1200
     tttcctcatc acagatgaag tagttgacta tatcagtggt ggaggcttca gcaatgtttt      1260
     cccacggcct ccctaccagg aggaagcagt ggcccagttc ttgaaatcca gctctcatct      1320
     accaccatcc agttacttca atgctagtgg ccgtgcctac ccagatgttg ccgcactatc      1380
     tgatggctac tgggtggtca gcaacatggt ccccattcca tgggtatctg gaacctcggc      1440
     ctctactcca gtgtttgggg gaattttatc cttgataaat gagcacagaa tcctcaatgg      1500
     ccgccctcct cttggctttc tcaaccccag gctctatcag cagcatggga caggactctt      1560
     tgatgtaacc cacggctgcc atgagtcctg tctgaatgaa gaagtggagg gtcagggttt      1620
     ctgctctggt cctggctggg atcctgtgac aggttgggga acacccaact tcccagccct      1680
     actgaagacc ctgctcaacc cttgaccctt tcgtgccatg acgagaaagc agaactgttc      1740
     cctgtactaa aagggaaggc tcagtttctt gttattcctc gatagaagcc ctgctgaact      1800
     cctgttgcct gctgcagata gcttctccct aaccctcaga tgctgtgaac aggactcaac      1860
     tctcaatcct actgtgtgcc atcaaactca ggtctccaaa cttctacttc aagatcctca      1920
     acaagatgct ataaccagca tattttgtct caccccaacc ccatctctcc ttcctctttc      1980
     cagcttgaga tgtgaaagca gggcaagaag gttcagtctt ccattactga cactagcagg      2040
     tccacccaac gcttaccacc tctgcactga ccgtacactc tatttctctt cgggtttgct      2100
     tttccgttca ctgaagtgag acctttgact aatcgttttg tctttcttct ctcggcactg      2160
     aagtacaatg gtctccccaa tgttttatcc agttataccc ttttcagtgt ttgttttatg      2220
     ggttttctta tttaagaaca ggttgtcaaa aaaccattaa aaaaaaaaaa gaaaaagaac      2280
     acattggctg caatctattt aactatataa ctattctaag gaaagttaaa aattgaaaac      2340
     ttaaaatgtt tgaaatgttc tcattggcaa aattcctcaa caaaataaat aggtcattac      2400
     aaattttgct ttaaattttt gcttgagtga tttttttttt tgtaaagtgt tttaaaattt      2460
     acattttatt ttccccttct cagctacacc aaagcaacat tcaggtttta atttcaactg      2520
     tcagacatta caaacatcta gcttctgtga acctgggtgt ttgttctttc catcagtttc      2580
     ccatttatcc tttttcctca gtgacccccc tctgaccaca ctaatcagcc cccttttctg      2640
     ctgactccag ggatgctgtg ttcattgttc cattcttagt ttcttgctct tatcatttta      2700
     ttatcatccc ttgacagatc actgacatct atacccacag tgagtgatac ctcaaatgtg      2760
     agatacctcg ttacttcatc tccctccagc ccagacctaa actatttcat ctcttaatct      2820
     atgatataat gcctctttca aacaagccag aaacctataa ctcttaactc tcatcttttt      2880
     cacctcctta ctaacttcaa aaagttttct tgactgcctc tcaagtatat ctttatcggc      2940
     tagtgtggtg atgcacacct ttaatcccag cactcaggag acagaggcca ggcaagtctc      3000
     tgagtttgag gccatcctgg tctatataaa gagttccaga caagccaggc ctacatagtc      3060
     agaccatgtc tcaaaaatac acatatgtgc acacacacac atgcacaaaa tactgcatta      3120
     tctttgagcc catgttcttt tttcttctaa actgcaggaa gcacttgggg agaggaaagg      3180
     cttccgaagc ccctcatctt ccaaaccaag cagtctatgt atttgtgcaa acccttcaaa      3240
     gattactggg taaaagtcag agacattgaa acttgccttc aaaatcggga aataaacatt      3300
     gctaatgtct cacacttgg                                                   3319
//


spacer
spacer