spacer

EBI Dbfetch

ID   AK169868; SV 1; linear; mRNA; HTC; MUS; 3195 BP.
XX
AC   AK169868;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630001P18 product:solute carrier family 17
DE   (anion/sugar transporter), member 5, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3195
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c0a627d941425f327107e17f67eca732.
DR   Ensembl-Gn; ENSMUSG00000049624; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117645; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119213; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630001P18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3195
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630001P18"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             28..1515
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 17 (anion/sugar transporter),
FT                   member 5 (MGD|MGI:1924105 GB|NM_172773, evidence: BLASTN,
FT                   99%, match=3173)"
FT                   /db_xref="GOA:Q8BN82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1924105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BN82"
FT                   /protein_id="BAE41423.1"
FT                   /translation="MRPLLRGPAGNDDEESSDSTPLLPGARQTEAAPVCCSARYNLAIL
FT                   AFCGFFVLYALRVNLSVALVDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTGKKYKWD
FT                   AETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVT
FT                   LVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICY
FT                   YMNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKVVP
FT                   WGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWL
FT                   CMILCGQAADYLRVKWNFSTISVRRIFSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTIS
FT                   TTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKSLTPDNTIREWQT
FT                   VFCIAAAINVFGAIFFTLFAKGEVQSWALSDHHGHRN"
FT   polyA_signal    3172..3177
FT                   /note="putative"
FT   polyA_site      3195
FT                   /note="putative"
XX
SQ   Sequence 3195 BP; 831 A; 716 C; 738 G; 910 T; 0 other;
     ggccggcaca tctgctctcc aggcgttatg aggcccctgc ttcggggtcc ggcgggaaac        60
     gacgatgagg agagctcgga cagcaccccg ctcctgccgg gcgcccggca gaccgaagcg       120
     gctccagtgt gctgctctgc tcggtacaac ttagcgattt tggcgttctg cggtttcttc       180
     gttctctatg ccttacgggt gaacctgagt gttgcgttag tggacatggt agattcaaat       240
     acaactctga ctgataatag aacgtctaag gagtgtgcgg aacattctgc ccccataaaa       300
     gttcaccaca atcacacagg taaaaagtac aagtgggatg cagaaactca agggtggatt       360
     ctcggctctt ttttttacgg ctacatcgtc acccagattc ccggtgggta cattgccagc       420
     agggtcggag ggaagctgct gctgggcctg ggcatcttag gcacctccgt cttcaccctg       480
     ttcacaccgc tggccgcaga cttaggcgtg gtgactctcg ttgtgcttag agcgctggaa       540
     ggactgggag agggtgttac gtttccagct atgcacgcca tgtggtcttc ctgggctccc       600
     cctctggaaa gaagcaagct tcttaccatt tcctatgcgg gagcacagct tgggacagtg       660
     atctcacttc ctctttccgg aataatatgc tactatatga actggactta cgtcttctat       720
     ctttttggta tagttggaat tgtctggttt attttatgga tgtggatagt cagtgataca       780
     ccagaaactc acaagacaat ctcccattat gaaaaagaat acattgtttc atcattaaaa       840
     aatcagcttt cttcgcagaa ggtggtgccg tgggggtcca tcttgaagtc actgccactt       900
     tgggcaattg tggtagcaca tttctcctac aactggtctt tttacacctt attgacgcta       960
     ctgccaactt atatgaagga aatcctaagg ttcaatgttc aagagaacgg gtttttatct      1020
     gcattgcctt attttggctg ttggttatgc atgatcctct gtggtcaagc cgctgactat      1080
     ttaagggtca agtggaactt ttcaactata agcgttcgga gaatttttag cctcgtagga      1140
     atggttggcc ctgcggtttt cctagtcgcg gctggattta taggctgtga ctattccttg      1200
     gccgttgcgt tcctaaccat atccacgacg ctgggaggct tcgcctcttc tggatttagc      1260
     atcaaccatc tggatatcgc tccttcgtat gctggcatcc tcttgggcat cacaaacacg      1320
     tttgccacta ttcccgggat gacgggaccc atcattgcta aaagtctgac ccctgataac      1380
     actattaggg aatggcagac tgtcttctgt atcgctgctg ctattaacgt gtttggggcc      1440
     attttcttca cgctgtttgc caaaggggaa gtgcagagct gggctctcag tgaccaccac      1500
     ggacacagaa actgaagaca acaaacaata attaatgtgt ttttatttat catggaaact      1560
     gaaagtgcct ttggtatttg aatgtgcaag cattctatgt gagagaaaaa aagtacttat      1620
     atttgtatgg taatcatgaa atgttactag ttccaagatc atataaaatg agctgttggg      1680
     ctggacagat ggctcagtgg ttacgagcac tgattgctct tggagaggtc ctgagttcaa      1740
     ttcccagcaa ccacatggtg gctcataacc atctgtaatg ggatcagatg ccctcttctg      1800
     gtgtgtctga agacagagac agtgtactca cacacattaa ataaataaat aaatctttaa      1860
     aaaaaaagaa gaagaagagg ctggtcctct tttaaaaaaa taaataaaaa ataaaatgag      1920
     ctgtttttaa ttattactag tatatctgcc aggccgtata ctgggttcac atatcaggct      1980
     gcaggaaagg cagtatgata taaggtaagg gcataggaaa tgaagctgaa atggacacac      2040
     acacacacac acacacacac actgataaac ttggttaatt aaatcagata aatcatttca      2100
     gatcttatta aaatacctgc ttttgtctac ttcccttata aaaatgcttg ccaactctcc      2160
     ctgacaccta gacctcaata acgtctccaa agaactgcca gccacagtaa gagtcggcag      2220
     cctggcagcg gtactggggg atccgtgccc aggcagctgt caagcattcc ctccctggct      2280
     gcagggcagg aatgcccagc acttaccagg gatggtggct tccaagtgca gggccaatga      2340
     caagtgtttg gctgacactc tttcccccat ggctgttaat gtgcagataa agctctaagt      2400
     ggactggagc agtgggagcc atagctactg tcttgacact gccagcctgc ctcggcagca      2460
     cccgggcccg actcctggca ggtgatctac aaagcagaag cgtggtaccc agtcagtcac      2520
     agagaatagc atccttgatt cacatcactg gcccatgaat tggagaacac attttcacat      2580
     tcaggttttt ctagctacat tagaactttt ttaaatgtct tacatttctt cccttcagtc      2640
     tgtcttgatt tatgcttctg gttacagttt aaagggactt tcagggccag gggtttggct      2700
     cagtggtaga gcatttacat aggattgtgc tccattcaac accaaaatag aggtaaaagg      2760
     cagggcaccc aaagcttgtc agtccccttt accctgcttc ctgaccagtg tctcccagtg      2820
     gttaggcaca ctgtaagagg tccctagtct gtgtggtggt acctttaatg ccagcacttg      2880
     ggaggcagaa gcaggcagat ctttgcgact tcgaggccag tctggtctgc aaaggggctt      2940
     ccaggacagc cggggctata actcaaaaac aaaaacaaaa agattatcca aggattgaaa      3000
     gcctgcctta tgttttgttg tatctgttca acacttatct ataacatttt aactaatgat      3060
     tggttaatgt actgttgtgt aaatacagtt atataaattt gtttttaatt tgtaaatata      3120
     aattaagttg ccatgtgaca tttcttttat aaatcatcaa aatccttttg cattaaattt      3180
     ttgtgttttt atttt                                                       3195
//


spacer
spacer