spacer

EBI Dbfetch

ID   AK169379; SV 1; linear; mRNA; HTC; MUS; 2811 BP.
XX
AC   AK169379;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 16 days embryo heart cDNA, RIKEN full-length enriched library,
DE   clone:I920193M14 product:protein phosphatase 1, catalytic subunit, beta
DE   isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2811
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 145a8aed2d0deb439c30964e36469672.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131300; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920193M14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2811
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920193M14"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             136..1119
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871 GB|NM_172707, evidence: BLASTN,
FT                   99%, match=2772)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAE41126.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2811 BP; 796 A; 477 C; 590 G; 948 T; 0 other;
     ggggagggcc cgcgcccggg gggagttgga gccggggtcg aaacgccgcg tgactcgtag        60
     gtgagaacgc cgagccgccg ccgccgccga gaagccctgt taacgcttta gggaggagag       120
     tctggtgcca acaagatggc ggacggggag ctgaacgtgg acagcctcat cacccgcctg       180
     ctggaggtac gaggatgtcg tccaggaaag attgtacaaa tgactgaagc agaagtccga       240
     gggttgtgta tcaagtctcg tgaaatcttt ctcagccagc ctattctttt ggaattggaa       300
     gcaccactga agatttgtgg agacattcat ggacaatata cagacttact aagattattt       360
     gaatatggag gttttccacc agaagccaac tatcttttct taggagatta tgtggacaga       420
     ggaaagcagt ctttggaaac catctgtttg ctattggctt acaaaatcaa atacccggag       480
     aacttctttc ttctaagagg aaaccatgag tgtgctagca tcaatcgcat ttatggattc       540
     tacgatgagt gtaaacgaag atttaatatt aaattgtgga agacattcac tgattgtttt       600
     aactgtctgc ctatagctgc tattgttgat gagaaaatct tctgttgtca tggaggactg       660
     tcaccagacc tacaatctat ggaacagatt cggagaatta tgagacccac tgacgtacct       720
     gatacaggtt tgctttgtga cttactgtgg tccgacccag ataaggatgt gcaaggctgg       780
     ggagaaaatg accgtggtgt ttcttttact tttggagctg atgtagtcag taaatttctg       840
     aatcgtcatg atttagactt gatttgtcga gctcatcagg tggtggaaga cggatatgaa       900
     ttttttgcta aacgacagtt ggtaacctta ttttctgccc caaattactg tggcgagttt       960
     gacaatgctg gtggtatgat gagtgtggat gagactttga tgtgttcatt ccagatattg      1020
     aaaccatctg aaaagaaagc taagtaccag tatggtgggc tgaattctgg acgtcctgtc      1080
     actccgcctc gaacagctaa tccaccgaag aaaaggtgaa gacaggaatt ctagaaagag      1140
     aaaccatcag atttgttaag gacatacttc ataatatata agtgtgcact gtaaaaccat      1200
     ccagccattc gacacccttt atgatgtcac acctttaact taaggagacg gtaaaggatc      1260
     ttaaattttt ttctaataga aagatgtgct acactgtatt gtaataagta tactctgtta      1320
     taatattcaa caaaattaaa tccaaattca aaagtatcca ttaaagttct atcttctcat      1380
     atcacagttt ttaaagttga aaagcatccc agttaaacta gccctgttag tgacccagat      1440
     gaaagcatga agatccatct gtgtaatgtg gttttagtgg tgcttggttg tttcattatt      1500
     ttgagcttgt tttgttttgt ttgtttttgc tagaataatg gcatctactt ttcctatttt      1560
     tccctaaaca tttttaaaag tgaaaatggg aagagcttta aagacattca ccaactattc      1620
     ttttccttta cttatctact taagtaactg ttggatctta ctaagaaaac ttacccctca      1680
     ttacagtaaa aaggaacttt agaggtcgat aggttttaaa aatatacaaa ctatctgatc      1740
     cattgatttt aatcaaacag tttgactggg caaactttgc agctgataat gagtatttcg      1800
     ctttttacaa aattgccact gatttggatt tgtgcactct aatctttaat ttattgatgc      1860
     tctattgtgc agtagcattt catttaagat aaggctcata tagtaatatc caaaactagt      1920
     tggtaatgtg attatgtggt actttggctt tgggttctaa ttcgcacgaa acaccttttg      1980
     gcatgcttaa ctttctggta ttaccctcac ctgcattggt tttgtttttt ggggtttttg      2040
     ttgtttgttt gtttttagat tcacagaaca tgagaatcct ttttgacaag ccttggatag      2100
     ctggctctct tctttccctc tctctatgtg aaggatgtat ttaaatgaac gctggtcagt      2160
     gggacatttg tcagctctga atattgggtg cttcactaat aattgccatg tgaatgttgt      2220
     tttgactgta aggctatgtc actaaagatt tttactctgc gttttcataa tcaaaggtca      2280
     tgatgtgtat agacatgctt tgtagtgaag tatagtagca ataatttctg tatgtgatca      2340
     agagtttatt gcattatttc tttccctgtt ctcttttttt tttttttaag ggttagcatt      2400
     aacaaatgtc aaggagtagc aaagtcaaca aagattttag aaggaggagg aactaagagc      2460
     atacacagac ttatgattct ttggatgtga cacttattgg atgtgattct aaagtctttt      2520
     attgaacatt gtcaaattcg tacgcttcat aggatggaca taatgtttat ataatgccct      2580
     tcttatgtgt taccatagat gtgtgaaacc ttatagcgtc cttgaaagtg ttaaattgag      2640
     aactctgtta acattttatg gattgacaca ttatattact gcaagtaaca tttgattttc      2700
     agcacagtgc aaaagttctt taaaatgcat atgtcttttt ttttctaatt ccattttgtt      2760
     taaagcacat tttaaatgta gttttctcat ttagtaaaag ttgtctaatt g               2811
//


spacer
spacer