Dbfetch

ID   AK169286; SV 1; linear; mRNA; HTC; MUS; 4155 BP.
XX
AC   AK169286;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus cDNA, RIKEN full-length enriched library, clone:I920176A16
DE   product:oxoglutarate dehydrogenase (lipoamide), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4155
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f716b3be629be72ccfb1c1c6ec35e70f.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018020; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017993; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017957; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017961; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017774; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018413; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017336; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017749; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017859; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017851; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017930; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017877; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018453; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017390; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027975; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027945; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027906; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027924; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027722; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028424; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027327; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027651; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027778; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027765; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027893; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027747; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028452; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027024; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027232; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920176A16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4155
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920176A16"
FT                   /note="pooled tissues: (dev_stage=16 days
FT                   embryo,tissue_type=heart,sex=mix),(dev_stage=16 days
FT                   embryo,tissue_type=kidney,sex=mix),(dev_stage=17 days
FT                   embryo,tissue_type=heart,sex=mix),(dev_stage=17 days
FT                   embryo,tissue_type=stomach,sex=mix),(dev_stage=17 days
FT                   embryo,tissue_type=kidney,sex=mix),(dev_stage=17 days
FT                   pregnant, adult,tissue_type=amnion,sex=female),
FT                   (dev_stage=13 days embryo,tissue_type=liver,sex=mix)"
FT                   /db_xref="taxon:10090"
FT   CDS             116..3187
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="oxoglutarate dehydrogenase (lipoamide)
FT                   (MGD|MGI:1098267 GB|BC013670, evidence: BLASTN, 100%,
FT                   match=3999)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="BAE41044.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSL
FT                   ATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPA
FT                   DIISSTDKLGFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEF
FT                   MFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLE
FT                   GCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAA
FT                   DEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTE
FT                   GKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSS
FT                   PYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMD
FT                   EPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDE
FT                   KILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGL
FT                   SRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQN
FT                   VDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNM
FT                   AQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDL
FT                   QEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTS
FT                   FDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRI
FT                   EQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRD
FT                   PAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
XX
SQ   Sequence 4155 BP; 999 A; 1115 C; 1073 G; 968 T; 0 other;
     ggttgacgcc acacgccggg gcggggctga gagtttggag cccggagtgg tgtcggcgct        60
     tcactcgggt ggagctgaac gggagacagg tacttgtgga aggcttcagg acaaaatgtt       120
     tcatttaagg acttgtgctg ctaagttaag gccattgaca gcctcccaga ctgttaagac       180
     attttcacaa aacaaaccag cagcaattag gacgtttcaa cagattcggt gctattctgc       240
     acctgtagct gctgaaccat ttcttagtgg gactagttcg aactatgtgg aggaaatgta       300
     ctgtgcctgg ttggagaatc ccaaaagtgt acataagtca tgggacattt ttttccgaaa       360
     caccaatgct ggagccccac cgggcactgc ctaccagagc cccctttccc tgagtcgaag       420
     ctccctggct accatggccc atgcacagtc cctggtggaa gcacaaccta acgtcgacaa       480
     actcgtggag gaccacttgg cggtgcagtc tctcatcagg gcatatcaga tacgagggca       540
     ccatgtagca cagctggacc ccctggggat tttggatgct gatctggact cctccgtgcc       600
     cgctgacatt atctcatcca cagacaaact tgggttctat ggcctacacg agtctgacct       660
     tgacaaggtc ttccacttac ccaccaccac tttcatcggg ggacaggagc cagcacttcc       720
     tcttcgggag atcatccgtc ggctggagat ggcctactgc cagcacattg gtgtggagtt       780
     catgttcatt aatgatttgg aacaatgcca gtggatccga cagaagtttg agacccctgg       840
     aatcatgcag ttcaccaatg aggagaagcg gaccttgctg gccaggcttg tacgatccac       900
     caggtttgag gagttcctac agcgaaagtg gtcctcggag aagcgttttg gtctggaagg       960
     ctgtgaggtg ctgatccctg ccctcaagac aatcattgat atgtcaagtg caaatggagt      1020
     ggactatgtg atcatgggga tgccacacag aggacggctg aacgtgcttg caaatgtcat      1080
     caggaaggag ctggagcaaa tattctgtca gtttgactca aagctggagg cagctgatga      1140
     gggttctggg gacatgaagt accacctggg catgtatcac cgcaggatca accgtgtgac      1200
     cgacagaaac atcactttgt ccttggtggc taacccttcc catctagagg ctgctgaccc      1260
     tgtcgtgatg ggaaagacca aagctgaaca gttctactgt ggagacactg aagggaaaaa      1320
     ggtgatgtct atcctgctgc atggggatgc tgcttttgct ggccagggca tcgtatatga      1380
     gaccttccat ctcagcgact tgccgtccta cacaacccat ggcactgttc atgtggttgt      1440
     caacaaccag attggcttca ccacagaccc tcggatggcc cgctcctctc cctaccccac      1500
     tgatgtggcc cgagtggtga atgcccccat tttccatgtc aactcagatg accctgaagc      1560
     tgtcatgtat gtatgcaagg tggcagctga gtggagaaac accttccaca aggatgttgt      1620
     agttgatctg gtgtgttatc gacgaaatgg ccacaatgag atggacgaac ctatgtttac      1680
     acagccactc atgtacaagc agatccgcaa gcagaagcct gtactgcaga agtatgcaga      1740
     attgctagtc tcccagggtg tcgtcaatca gcctgagtac gaggaggaaa tctccaagta      1800
     tgataagatc tgtgaggaag catttaccag atccaaagat gagaagatct tgcacatcaa      1860
     gcactggctg gattccccct ggcctggctt tttcaccctg gatggacagc ccaggagcat      1920
     gacctgcccc tccactggcc tggaggagga tgtcttgttc cacattggaa aggtggccag      1980
     ctctgtacct gtggagaact ttactatcca tggagggctg agccggatct tgaagacccg      2040
     cagagagctt gtgacgaacc ggactgtgga ctgggccctg gcagagtaca tggcatttgg      2100
     ctcactgctg aaggaaggca tccatgtgcg gctgagtggc caggatgtgg agcggggcac      2160
     cttcagccat cgccaccatg tgctccatga tcagaatgtt gacaaaagaa cctgcatccc      2220
     catgaaccac ctttggccaa atcaggcccc ttacactgta tgcaacagct cgctgtctga      2280
     gtacggtgtc ctgggctttg agctgggctt tgccatggct agccctaatg ctctggttct      2340
     ctgggaggcc cagtttggtg acttcaacaa catggcacag tgcatcattg accagttcat      2400
     ctgcccagga caggcaaagt gggtgcggca gaatggcatt gtgctcctgc tgcctcatgg      2460
     catggaaggc atgggtcccg agcattcctc tgcccgccca gagcggtttc tgcagatgtg      2520
     caatgatgac ccagatgtcc tgcctgacct gcaggaagaa aactttgaca tcaatcagct      2580
     ctatgactgc aactggattg ttgtcaactg ttccacccct ggcaacttct tccatgtgct      2640
     gcgacgacag atcttgctgc ccttccggaa gccgttaatc gtcttcactc ccaaatccct      2700
     cctgcgccac cctgaggcaa gaactagctt tgacgagatg ctgccaggaa cgcacttcca      2760
     gcgtgtgatc ccagaaaatg gacctgcagc tcaggaccca cacaaagtca agagacttct      2820
     cttctgcact gggaaggtgt actatgacct cacccgagag cgcaaagcca ggaacatgga      2880
     ggaggaggtg gctattacaa ggattgagca gctatcacca ttcccctttg acctcctgct      2940
     gaaagaggca cagaagtatc ccaatgctga gctggcctgg tgccaggaag agcacaagaa      3000
     ccaaggctac tatgactatg tcaagccaag acttcgtacc accattgacc gtgctaagcc      3060
     tgtctggtat gctggccgag acccggcagc tgctccagcc actggcaaca agaaaacaca      3120
     cctgacagag ctgcagcgct ttctggacac agcctttgac ctggacgcat tcaagaaatt      3180
     ctcttagatg ctcctggagt tgatgaggcc atggccccca tgtccatgac gctctttgct      3240
     tctcaactaa agaatagtgc ctcagcactg tccacacgtc ccttcgctgt gccacaccac      3300
     ccctgttctc ataggaatta agttgtccac tgcagtgctc agctgctccc cggtcacatg      3360
     ctgcccagcc tgtgccgact tctctcaggc tgcacaccgt tcatggagac cggaaggagc      3420
     agaataagga aagggcccct ctcaggacat cctagagaag gaaggcagct ctggccccac      3480
     ccatgccccc agtgcaatcc tccagggtag gaacagaacc ctatgtggct tcccagggta      3540
     ctagcactca gccctcgtca cccatcaagt cgcagattca aggccaggag tagtttcatc      3600
     ttgctagggc caagctgaga gctcatggag gaactatagc tgccaggatt tgggagtcat      3660
     caggatgttg tgtgaataga gattgtcatg gggtatttag aggactttag cagtgatgtt      3720
     agtctagccc tgctaccctt cttgggtttg ggctgtatgt gggaaactta ccccagctac      3780
     cacgcctgga gagcttggct ctgagtacgg cccagaagct ccattggctc ccaacgccag      3840
     gcactgctgc ctcttggtcc tgctgcctct gctctcctga cccctcccca gtcacttcat      3900
     tttctctgtt gttcccttga acacacagaa gctgttgacg aattcttttt tttgctgtgc      3960
     caaggcaggt caaaagcaga tcagtggata agagcaagtt gtcccaagga gccagctgtc      4020
     cttcctccct cttttgacct ccactgggac acacctgatt tatttatttt ggttaaaaaa      4080
     aaaaaaagga aatgaaaaaa gaacaaccac ctttgcattg catcggcttg acccataaac      4140
     taagttatca tggcc                                                       4155
//