spacer

EBI Dbfetch

ID   AK169195; SV 1; linear; mRNA; HTC; MUS; 1842 BP.
XX
AC   AK169195;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 13 days embryo liver cDNA, RIKEN full-length enriched library,
DE   clone:I920089D15 product:aldehyde dehydrogenase family 7, member A1, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1842
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0343d24187c7ea090c1724bb56b0ff3f.
DR   Ensembl-Gn; ENSMUSG00000053644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174518; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920089D15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1842
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920089D15"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             18..1637
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="aldehyde dehydrogenase family 7, member A1
FT                   (MGD|MGI:108186 GB|NM_138600, evidence: BLASTN, 100%,
FT                   match=1806)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9DBF1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="MGI:MGI:108186"
FT                   /protein_id="BAE40971.1"
FT                   /translation="MWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDL
FT                   GLREDNEGVYNGSWGGRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWAD
FT                   IPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRM
FT                   IGGPTLPSERPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPT
FT                   TSLVSVAVTKIIAQVLEDNLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKE
FT                   VALMVQERFGKSLLELGGNNAIIAFEDADLSLVVPSVLFAAVGTAGQRCTTVRRLFLHE
FT                   SIHNEVVDRLRSAYSQIRVGNPWDPNILYGPLHTKQAVSMFVRAVEEAKKQGGTVVYGG
FT                   KVMDHPGNYVEPTIVTGLAHDAPIVHQETFAPILYVFKFQDEEEVFEWNNEVKQGLSSS
FT                   IFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYM
FT                   RRSTCTINYSTSLPLAQGIKFQ"
XX
SQ   Sequence 1842 BP; 447 A; 442 C; 532 G; 421 T; 0 other;
     ggcgtgctga gctcagtatg tggcgtgtgc cccgcaggct ctgtgtgcag tctgtgaaga        60
     ccagcaagct ttccggacct tggagcaggc ccgccgccca catgtctact ctgctgatcc       120
     atcatcccca gtatgcctgg ctgcaagacc tggggctccg cgaggataac gagggcgtgt       180
     ataatggaag ctggggcggc cggggagagg taattacgac ctattgtcct gctaacaatg       240
     agccaatagc aagagtccga caggccagcc tgaaggacta tgaagaaacc atcgggaaag       300
     ccaagaaagc ctggaacatc tgggcagata ttcctgcccc aaaacgcgga gaaatagtca       360
     gaaagattgg cgatgccttc cgggagaaga tccaactact gggaagactg gtgtctttgg       420
     agatggggaa aatcctggtg gaaggaatag gcgaggttca ggagtacgtg gacgtctgcg       480
     attatgctgc tggcttgtcg aggatgatcg ggggacccac cttgccttct gaaagacccg       540
     gccatgctct catcgaaatg tggaatccct taggcttggt gggaatcatc actgccttca       600
     atttccccgt ggctgtgttt ggctggaaca atgccatagc tctgatcaca gggaatgtct       660
     gcctttggaa aggagcaccg actacgtccc tcgttagtgt ggctgtcaca aagatcatag       720
     cccaggtttt ggaggacaac ctgctgcccg gtgccatttg ttccctggtt tgtggtggag       780
     cagatatcgg cacaacgatg gccagagatg agcgtgtgaa cctgctgtcc ttcactggga       840
     gcactcaggt ggggaaggag gtggccctca tggtgcagga gaggtttggg aaaagcttgt       900
     tggagcttgg aggaaacaat gccattattg ctttcgagga cgcggacctc agcttggttg       960
     ttccgtcagt tctgtttgcc gccgtgggaa cagctgggca aaggtgtacc actgtgagga      1020
     gactgttttt gcacgaaagc atccataatg aagttgtgga cagactgaga agtgcctact      1080
     cacagatccg tgttgggaac ccctgggacc ccaatatcct ctatggaccg ctccatacca      1140
     aacaggcagt gagcatgttt gtgagagccg tggaagaagc caagaaacaa gggggcacag      1200
     tggtctatgg gggcaaggtc atggaccacc ctggcaatta cgtggaaccc accattgtga      1260
     ccggtcttgc ccatgatgcg cccattgttc accaggagac ttttgcccca atcctctatg      1320
     tcttcaaatt ccaggatgaa gaagaggtct ttgaatggaa caatgaagta aaacagggac      1380
     tttcaagtag tatctttacc aaagatttgg gcagaatctt ccgctggctt ggacctaaag      1440
     gttccgactg tggcatcgtg aacgtcaata ttcctaccag cggggctgag attggtggtg      1500
     cgtttggcgg agagaagcac actggcggtg gccgggagtc tggcagcgac gcctggaagc      1560
     agtacatgag gagatccaca tgtaccatca actacagcac gtccctccct ctggctcagg      1620
     gaatcaagtt tcagtgatac tgcgtgggct tggcgtccct tagccattcc tgtggctgct      1680
     cggaagaagc ctgaaaggac cctgacttgc cccggataaa tgatggcttt gagtacggac      1740
     agcagtgtct aatctccagt gattcccaga cccctgtcta aatcaagata ctcatttatc      1800
     aaaagttcaa aattaaatat tcacaaccta gctgcattta gc                         1842
//


spacer
spacer