spacer

EBI Dbfetch

ID   AK169046; SV 1; linear; mRNA; HTC; MUS; 2010 BP.
XX
AC   AK169046;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 17 days pregnant adult female amnion cDNA, RIKEN full-length
DE   enriched library, clone:I920076M10 product:alpha fetoprotein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2010
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b4e5d70141a18755a591da0241230217.
DR   Ensembl-Gn; ENSMUSG00000054932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042755; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920076M10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2010
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="17 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920076M10"
FT                   /tissue_type="amnion"
FT                   /db_xref="taxon:10090"
FT   CDS             46..1863
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="alpha fetoprotein (MGD|MGI:87951 GB|NM_007423,
FT                   evidence: BLASTN, 99%, match=2010)"
FT                   /note="putative"
FT                   /db_xref="GOA:P02772"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR001703"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87951"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02772"
FT                   /protein_id="BAE40834.1"
FT                   /translation="MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLS
FT                   IATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESQLSVFLDEICHETELSNKY
FT                   GLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRFIYEVS
FT                   RRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNEHVCSV
FT                   IRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQDGEKVM
FT                   TYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNFAQFSS
FT                   EEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNLEEELQK
FT                   HIEESQALSKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCC
FT                   QLSEEKWSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFLRDETY
FT                   APPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLE
FT                   KCCKAQDQEVCFTEEGPKLISKTRDALGV"
FT   polyA_signal    1993..1998
FT                   /note="putative"
FT   polyA_site      2010
FT                   /note="putative"
XX
SQ   Sequence 2010 BP; 590 A; 466 C; 473 G; 481 T; 0 other;
     gacatcccac ttccagcact gcctgcggtg aaggaaccag cagccatgaa gtggatcaca        60
     cccgcttccc tcatcctcct gctacatttc gctgcgtcca aagcattgca cgaaaatgag       120
     tttgggatag cttccacgtt agattcctcc cagtgcgtga cggagaagaa tgtgcttagc       180
     atagctacca tcacctttac ccagtttgtt ccggaagcca ccgaggagga agtgaacaaa       240
     atgactagcg atgtgttggc tgcaatgaag aaaaactctg gcgatgggtg tttagaaagc       300
     cagctatctg tgtttctgga tgaaatttgt catgagacgg aactctctaa caagtatgga       360
     ctctcaggct gctgcagcca aagtggagtg gaaagacatc agtgtctgct ggcacgcaag       420
     aagactgctc cggcctctgt cccacccttc cagtttccag aacctgccga gagttgcaaa       480
     gcacatgaag aaaacagggc agtgttcatg aacaggttca tctatgaagt gtcaaggagg       540
     aaccccttca tgtatgcccc agccattctg tccttggctg ctcagtacga caaggtcgtt       600
     ctggcatgct gcaaagctga caacaaggag gagtgcttcc agacaaagag agcatccatt       660
     gcaaaggaat taagagaagg aagcatgtta aatgagcatg tatgttcagt gataagaaaa       720
     tttggatccc gaaacctcca ggcaacaacc attattaagc taagtcaaaa gttaactgaa       780
     gcaaatttta ctgagattca gaagctggcc ctggatgtgg ctcacatcca cgaggagtgt       840
     tgccaaggaa actcgctgga gtgtctgcag gatggggaaa aagtcatgac atatatatgt       900
     tctcaacaaa atattctgtc aagcaaaata gcagagtgct gcaaattacc catgatccaa       960
     ctaggcttct gcataattca cgcagagaat ggcgtcaaac ctgaaggctt atctctaaat      1020
     ccaagccagt ttttgggaga cagaaatttt gcccaatttt cttcagagga aaaaatcatg      1080
     ttcatggcaa gctttcttca tgaatactca agaactcacc ccaaccttcc tgtctcagtc      1140
     attctaagaa ttgctaaaac gtaccaggaa atattggaga agtgttccca gtctggaaat      1200
     ctacctggat gtcaggacaa tctggaagaa gaattgcaga aacacatcga ggagagccag      1260
     gcactgtcca agcaaagctg cgctctctac cagaccttag gagactacaa attacaaaat      1320
     ctgttcctta ttggttacac gaggaaagcc cctcagctga cctcagcaga gctgatcgac      1380
     ctcaccggaa agatggtgag cattgcctcc acgtgctgcc agctcagcga ggagaaatgg      1440
     tccggctgtg gtgagggaat ggccgacatt ttcattggac atttgtgtat aaggaatgaa      1500
     gcaagccctg tgaactctgg tatcagccac tgctgcaact cttcgtattc caacaggagg      1560
     ctatgcatca ccagttttct gagggatgaa acctatgccc ctcccccatt ctctgaggat      1620
     aaattcatct tccacaagga tctgtgccaa gctcagggca aagccctaca gaccatgaaa      1680
     caagagcttc tcattaacct ggtgaagcaa aagcctgaac tgacagagga gcagctggcg      1740
     gctgtcactg cagatttctc gggccttttg gagaagtgct gcaaagccca ggaccaggaa      1800
     gtctgtttca cagaagaggg tccaaagttg atttccaaaa ctcgtgatgc tttgggcgtt      1860
     taaacatctc cagaaggaag agtggacaaa aaaatgtgtt gactctttgg tgtgagcctt      1920
     ttggcttaac tgtaactgct agtactttaa ccacatggtg aagatgtcca tgtgagattt      1980
     ctatacctta ggaataaaaa cttttcaact                                       2010
//


spacer
spacer