spacer

EBI Dbfetch

ID   AK168906; SV 1; linear; mRNA; HTC; MUS; 2256 BP.
XX
AC   AK168906;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 17 days embryo kidney cDNA, RIKEN full-length enriched
DE   library, clone:I920064E20 product:adenylosuccinate lyase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2256
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 932e25eae64ae399657ac1613bd1f1bc.
DR   Ensembl-Gn; ENSMUSG00000022407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023043; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920064E20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2256
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="17 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920064E20"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             24..1478
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adenylosuccinate lyase (MGD|MGI:103202 GB|NM_009634,
FT                   evidence: BLASTN, 99%, match=2102)"
FT                   /note="putative"
FT                   /db_xref="GOA:P54822"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="MGI:MGI:103202"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54822"
FT                   /protein_id="BAE40720.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
XX
SQ   Sequence 2256 BP; 582 A; 561 C; 583 G; 530 T; 0 other;
     ggcgttctgg tcgcgtgttg aaaatggctg catccggcga ccctggcagt gctgaaagtt        60
     accgttctcc gctggcggcc cgctacgcca gccgcgagat gtgtttcttg ttcagcgaca       120
     ggtacaagtt ccagacgtgg cggcagctgt ggctgtggct ggcggaggcc gaacagacgc       180
     tgggtttgcc tatcacagat gaacaaatcc aggagatgaa gtcgaacctg aacaacattg       240
     acttccagat ggcagctgag gaagagaagc gcctgcggca cgacgtgatg gctcacgtgc       300
     acacgtttgg ccactgctgt ccgaaagctg cgggcattat tcatctgggc gccacctcct       360
     gctatgtcgg agacaatacg gacctgatta ttctgagaaa tgcatttgac ctacttttgc       420
     caaagcttgc tagagtgatc tcgaggcttg ccgactttgc taaggatcgt gctgatctgc       480
     ccacgttagg tttcacacac tttcagcctg ctcagctgac cacggttggg aaacgatgct       540
     gcctttggat tcaagatctc tgcatggatc tccagaactt gaagcgtgtc cgggatgagc       600
     tgcgcttccg aggagtaaag ggcaccactg gcacgcaggc cagcttcctg cagctcttcg       660
     agggggatca ccagaaggtg gagcagctgg acaagatggt gacagaaaag gcagggttta       720
     aaagagcctt catcatcaca ggacagacgt acacacggaa agtggacatc gaagtgctgt       780
     ctgtgctggc cagcttagga gcatcggtgc acaagatttg cactgacata cgcctgctgg       840
     caaacctgaa ggagatggag gagccctttg agaaacagca gattggctcc agtgcgatgc       900
     cgtacaagcg gaaccccatg cgctccgaac gttgctgcag cctggcccgt cacctgatgg       960
     cccttaccat ggacccacta cagacagcgt ctgtgcagtg gtttgaacgt actctggatg      1020
     acagtgccaa ccgacggatc tgtttggctg aagcgtttct cactgcagat actatattaa      1080
     acaccctaca gaacatttct gaaggattgg tggtgtaccc caaagtaatt gaacggcgca      1140
     ttcggcaaga gctgcctttc atggccacag agaacatcat catggcaatg gtgaaagccg      1200
     ggggcagccg acaggactgc catgagaaaa ttagagtgct ttcccagcag gcagctgctg      1260
     tggtcaagca ggaaggaggt gacaatgacc ttatagagcg catccgggca gatgcctact      1320
     tcagccccat ccactcacag ctggagcact tgctggaccc ctcttctttc actggccgag      1380
     caccccagca ggtccacaga ttcctggaag aggaagtgcg ccccctgcta aagccctatg      1440
     ggaatgagat ggcggtgaaa gcagagctgt gtctgtagag taggagagct gaggagaacc      1500
     cggttacagt gattagagct tgctgattac agtgttagag ttactactgt gttctgcggc      1560
     actcctttac acactcagga ggcagaggca ggcagatctc tgagttcaag gccagcctgg      1620
     tctacaaaac aagttccagg acagccagag ctacacagag aaaccctgtc tcaacaaaca      1680
     aacaaacaga ggctggggac atggcactga ctgctcttcc aaaggtcctg agttcaaatc      1740
     ccagcaacca catggtggct cacaaccatc tgtaatgaga tctgatgccc tcttctggtg      1800
     catgaagaca gctacagtgt attcatatac ataaaataaa tgaatcttta aaaacaaaca      1860
     aaaagaatgt acattaagtt ctcttgcttg gggttcacaa cagatagccg tgctttcttg      1920
     ttttctccag tcttttgttg ttgagacaga gtctcaatgt gtatcattgg ctgacctgga      1980
     acacagaaat ctgcctcatc tccccagtgg caggattaaa ggtgtgctcc accatgcctg      2040
     gctgttttat attttttaca gcaacataat cttgcagaat aatgtagctc atacttattt      2100
     tccagatgcc ttgagtctac aatgtttcct cacttacagt gagattgtgt caccataagg      2160
     aaatgagttc agttcaccta tcaaacattg ttatgtgctc ataacacttg acagtaactt      2220
     ctggtccaag atcccctaac aaactgtatt agtaat                                2256
//


spacer
spacer